KEGG   Saccharomyces cerevisiae (budding yeast): YDL230W
Entry
YDL230W           CDS       T00005                                 

Gene name
PTP1
Definition
(RefSeq) tyrosine protein phosphatase PTP1
  KO
K01104  protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YDL230W (PTP1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     YDL230W (PTP1)
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 PTPlike_phytase Myotub-related
Other DBs
NCBI-GeneID: 851368
NCBI-ProteinID: NP_010051
SGD: S000002389
UniProt: P25044
Position
IV:42700..43707
AA seq 335 aa
MAAAPWYIRQRDTDLLGKFKFIQNQEDGRLREATNGTVNSRWSLGVSIEPRNDARNRYVN
IMPYERNRVHLKTLSGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHN
CPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIE
FVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHS
LNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQI
VLQLRSQRMKMVQTKDQFLFIYHAAKYLNSLSVNQ
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcagctgcaccatggtatattagacagcgtgacacggatttattgggtaaattcaag
ttcatacagaatcaagaagacggcagattaagggaagctacaaacggaacggtgaattca
cgatggtcgttgggggtcagcatagaacctcgtaacgatgctagaaacagatacgttaac
attatgccgtatgagaggaaccgcgttcatttgaagactctatccgggaatgattacatt
aatgcctcgtatgtcaaagtgaacgtgccagggcagagcatcgaaccgggctactatatt
gctactcaaggtcccacgcgtaaaacttgggatcagttttggcaaatgtgctatcacaat
tgtcctttagacaatattgtcattgtgatggtcacgcctctggtagaatacaatagggag
aagtgctaccagtactggcctcgcggtggtgtagacgatacggttagaatagcatcaaaa
tgggaaagtccgggcggcgccaatgatatgactcaatttccctctgatttgaaaatagag
tttgttaacgtacataaggtgaaggactattatacggtcaccgatatcaaactcacaccc
acggaccctcttgtaggacctgtcaaaactgttcaccacttttacttcgacctttggaaa
gatatgaacaagccagaggaagtagtacccataatggaattatgcgctcactcccacagc
ttgaattcccgcgggaaccccattatcgtacactgttccgcaggcgtgggcagaacgggg
acgttcattgccctagatcatctcatgcatgataccttggattttaaaaatattacagaa
cggtcaaggcattcagacagggctacagaggagtacacacgggacttgatcgaacagatc
gtgttacagttgcgctcgcaaagaatgaaaatggttcagacaaaggatcagttcctattt
atctaccatgctgccaagtatcttaacagtctttccgtgaaccaatag

DBGET integrated database retrieval system