KEGG   Saccharomyces cerevisiae (budding yeast): YDL234CHelp
Entry
YDL234C           CDS       T00005                                 

Gene name
GYP7
Definition
(RefSeq) Gyp7p
  KO
K20168  TBC1 domain family member 15
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDL234C (GYP7)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    YDL234C (GYP7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RabGAP-TBC DUF1451
Motif
Other DBs
NCBI-GeneID: 851364
NCBI-ProteinID: NP_010047
SGD: S000002393
UniProt: P48365
Position
IV:complement(34237..36477)
Genome map
AA seq 746 aa AA seqDB search
MSKILFCKSKVFLHPTSDARDNIAGFLLLTLEANKLSHQAILQYIPESGLSTLEISKLLK
HEAKVGTCPTSTPFVIENSINFSNLVNTSLGQAFEISLSQIYCIQFRPPSPNGWYVGSLV
IYPLTEQFTGFQPPVLFFHDQLCPSTTDKLKRLRKSMNPFDDSDELYWGGVDLRNKINEL
MELKKSNLEPEFWLVNPSLNDLRNFVSKDLLESYNNSKKDTTELATAGVKLNEKFQEWKW
NVMSKIADVTTKSTNFIDSWLTNNSPIQKSQIDNEYLQKLLNNEKVKQIEQDYDSARVYL
ANWSLGVKQEAERYQKQNKLFDSYRNNIFNDLNLTDELSDTEINNALQRQFPLTEAKWNS
LWDENDGRLRVTVNEVKDFIFHGGLENDSLRGKVWGFLLEIYPWDSSQDERVQIDQTLAA
EYDQLKLTWSKDFLQFDDEDEEEYWNDQLFRISKDVRRCDRNLEIFQYNTIDGLPPPPQQ
LPANENNSTSPESANDESDDADDGVRNPHLIHLQNILITYNVYNTNLGYVQGMTDLLSPI
YVIMKEEWKTFWCFTHFMDIMERNFLRDQSGIHEQMLTLVELVQLMLPELSEHLNKCDSG
NLFFCFRMLLVWFKREFEMEDIMHIWENFWTFYYSSQFQLFFMLAILQKNSQAILQHLNQ
FDQILKFFNELNGKLDWNDLMVRAELLFKKFEKMMHVMERDLQNVSSSSSSSSTGVLPCQ
SERLTLLLSKKPIIRHEGQRSKNSVK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatactattctgcaaatctaaagtgttcttacacccaacaagcgatgctaga
gataatattgctggtttcctgctactcacattggaagcgaataagctatcccaccaagca
attctccaatatatcccagaatctggcttatccacattagagatatcaaaactactaaaa
catgaagctaaagtgggcacatgtccaacttctacaccatttgttattgaaaattcaata
aactttagtaacctggtcaatacttctttaggtcaagctttcgaaatttctctctcacaa
atatactgcatccaatttaggcctcctagtccaaatggttggtatgtcggatctctggta
atatatcccttgacagaacagtttacgggctttcaacctcctgtcttgttctttcatgac
caactctgcccatcaactacggacaagttaaaaagactacgcaaatccatgaacccattt
gatgactcggacgaattgtattggggtggcgtagatttgagaaacaaaatcaacgaactg
atggaactcaagaaatcaaacttagagccagagttttggttagtaaatccctctttgaat
gatttgagaaatttcgtttccaaggatctattggaaagttataacaattcgaagaaagat
acaactgaactcgctaccgccggtgtgaaactaaacgagaaattccaagaatggaaatgg
aacgtaatgagcaagatagcagacgtgactaccaagtctaccaattttatcgatagttgg
ctgactaacaactcacccatacaaaaatcacaaatcgacaatgaatacttgcaaaagctt
ctgaacaatgagaaggttaaacaaattgaacaggattatgactctgcaagagtgtatttg
gcaaactggtcattaggagtaaaacaggaagctgagaggtatcaaaagcagaacaaactc
tttgattcgtataggaataacattttcaacgacctgaatctaactgatgaattaagtgat
actgaaataaataatgctctgcaaagacaatttcctttaacggaagcgaaatggaattcg
ctatgggatgagaacgatgggaggctgagggtcacggtaaacgaagttaaggatttcata
tttcatggtgggttagaaaatgacagtttgcgagggaaagtttggggttttctcttagaa
atatatccgtgggattcttctcaagacgagagggtacaaatcgatcaaactttagccgcg
gaatacgatcaattgaaactaacctggtcaaaagattttttacaatttgacgatgaagat
gaagaggaatattggaacgatcaattattcagaatatctaaagatgtgagacgctgtgat
agaaacttggagatatttcaatacaataccatcgatggattaccaccaccgccacaacaa
ctcccagcaaatgaaaataacagtaccagccccgaatccgctaatgacgagagcgatgat
gcagacgatggagtcaggaacccacatttgatacatttacaaaacattcttatcacttat
aatgtctacaacacaaacttaggctacgtgcaggggatgaccgatcttttatcgcctatt
tatgtcatcatgaaggaagaatggaaaacgttttggtgttttacgcacttcatggacatt
atggaaagaaattttctaagagaccagagtggcatccatgaacaaatgttaactctcgtg
gaattggtacaattaatgctacccgaattgagcgaacatttaaacaagtgtgattcagga
aacttgttcttttgctttcgaatgcttctagtatggttcaagagagaatttgaaatggaa
gatattatgcacatttgggagaatttctggactttctactacagttcacaattccaatta
ttcttcatgttggccattctacagaaaaactcacaagctattttacaacatctaaatcag
ttcgaccaaatattaaaattttttaatgaacttaacgggaagttggattggaatgaccta
atggttagagcagagcttttgttcaagaagtttgagaaaatgatgcacgtcatggaaaga
gatttacaaaacgtatcctcctcttcatcctcatcctctaccggcgtattgccttgtcag
agcgagaggttgaccctgcttctttctaaaaaacctatcataagacatgaagggcaaagg
agcaaaaattccgttaaatag

DBGET integrated database retrieval system