KEGG   Saccharomyces cerevisiae (budding yeast): YDL235CHelp
Entry
YDL235C           CDS       T00005                                 

Gene name
YPD1
Definition
(RefSeq) Ypd1p
  KO
K11232  osomolarity two-component system, phosphorelay intermediate protein YPD1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Module
sce_M00516  SLN1-YPD1-SSK1/SKN7 (osmosensing) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YDL235C (YPD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sce02022]
    YDL235C (YPD1)
Two-component system [BR:sce02022]
 Other families
  SLN1-YPD1-SSK1/SKN7 [MD:M00516]
   YDL235C (YPD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hpt
Motif
Other DBs
NCBI-GeneID: 851363
NCBI-ProteinID: NP_010046
SGD: S000002394
UniProt: Q07688
Structure
PDB: 

Position
IV:complement(33415..33918)
Genome map
AA seq 167 aa AA seqDB search
MSTIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELD
NLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDED
DEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtctactattccctcagaaatcatcaattggaccatcttaaatgaaattatatctatg
gatgacgatgattccgatttttctaaaggtctaattattcaatttatcgaccaggcacaa
acaacttttgctcaaatgcaacgacagctggacggtgaaaaaaatcttaccgaattagac
aatctgggccattttttaaagggttcttctgctgcattaggcttacaaagaattgcctgg
gtttgtgaaagaattcaaaacttgggaagaaaaatggaacatttcttccccaacaagacc
gaattggtcaacactctgagcgataaatcgattattaatggaatcaatattgatgaagat
gacgaggaaataaagatacaagtggacgataaagacgaaaattccatatatctcatcttg
atagcaaaagctttgaaccagtctaggttggagttcaaactggcgagaattgagttatct
aaatattacaacacaaacctataa

DBGET integrated database retrieval system