KEGG   Saccharomyces cerevisiae (budding yeast): YDL236WHelp
Entry
YDL236W           CDS       T00005                                 

Gene name
PHO13
Definition
(RefSeq) 4-nitrophenylphosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     YDL236W (PHO13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase Hydrolase_like HAD_2 Acid_phosphat_B
Motif
Other DBs
NCBI-GeneID: 851362
NCBI-ProteinID: NP_010045
SGD: S000002395
UniProt: P19881
Position
IV:32296..33234
Genome map
AA seq 312 aa AA seqDB search
MTAQQGVPIKITNKEIAQEFLDKYDTFLFDCDGVLWLGSQALPYTLEILNLLKQLGKQLI
FVTNNSTKSRLAYTKKFASFGIDVKEEQIFTSGYASAVYIRDFLKLQPGKDKVWVFGESG
IGEELKLMGYESLGGADSRLDTPFDAAKSPFLVNGLDKDVSCVIAGLDTKVNYHRLAVTL
QYLQKDSVHFVGTNVDSTFPQKGYTFPGAGSMIESLAFSSNRRPSYCGKPNQNMLNSIIS
AFNLDRSKCCMVGDRLNTDMKFGVEGGLGGTLLVLSGIETEERALKISHDYPRPKFYIDK
LGDIYTLTNNEL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcaacaaggtgtaccaataaagataaccaataaggagattgctcaagaattc
ttggacaaatatgacacgtttctgttcgattgtgatggtgtattatggttaggttctcaa
gcattaccatacaccctggaaattctaaaccttttgaagcaattgggcaaacaactgatc
ttcgttacgaataactctaccaagtcccgtttagcatacacgaaaaagtttgcttcgttt
ggtattgatgtcaaagaagaacagattttcacctctggttatgcgtcagctgtttatatt
cgtgactttctgaaattgcagcctggcaaagataaggtatgggtatttggagaaagcggt
attggtgaagaattgaaactaatggggtacgaatctctaggaggtgccgattccagattg
gatacgccgttcgatgcagctaaatcaccatttttggtgaacggccttgataaggatgtt
agttgtgttattgctgggttagacacgaaggtaaattaccaccgtttggctgttacactg
cagtatttgcagaaggattctgttcactttgttggtacaaatgttgattctactttcccg
caaaagggttatacatttcccggtgcaggctccatgattgaatcattggcattctcatct
aataggaggccatcgtactgtggtaagccaaatcaaaatatgctaaacagcattatatcg
gcattcaacctggatagatcaaagtgctgtatggttggtgacagattaaacaccgatatg
aaattcggtgttgaaggtgggttaggtggcacactactcgttttgagtggtattgaaacc
gaagagagagccttgaagatttcgcacgattatccaagacctaaattttacattgataaa
cttggtgacatctacaccttaaccaataatgagttatag

DBGET integrated database retrieval system