KEGG   Saccharomyces cerevisiae (budding yeast): YDR009WHelp
Entry
YDR009W           CDS       T00005                                 

Gene name
GAL3
Definition
(RefSeq) transcriptional regulator GAL3
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00052  Galactose metabolism
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
Module
sce_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
sce_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YDR009W (GAL3)
   00520 Amino sugar and nucleotide sugar metabolism
    YDR009W (GAL3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     YDR009W (GAL3)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YDR009W (GAL3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_N GHMP_kinases_C DUF1748
Motif
Other DBs
NCBI-GeneID: 851572
NCBI-ProteinID: NP_010292
SGD: S000002416
UniProt: P13045
Structure
PDB: 

Position
IV:463434..464996
Genome map
AA seq 520 aa AA seqDB search
MNTNVPIFSSPVRDLPRSFEQKHLAVVDAFFQTYHVKPDFIARSPGRVNLIGEHIDYCDF
SVLPLAIDVDMLCAVKILDEKNPSITLTNADPKFAQRKFDLPLDGSYMAIDPSVSEWSNY
FKCGLHVAHSYLKKIAPERFNNTPLVGAQIFCQSDIPTGGGLSSAFTCAAALATIRANMG
KNFDISKKDLTRITAVAEHYVGVNNGGMDQATSVYGEEDHALYVEFRPKLKATPFKFPQL
KNHEISFVIANTLVKSNKFETAPTNYNLRVIEVTVAANALATRYSVALPSHKDNSNSERG
NLRDFMDAYYARYENQAQPWNGDIGTGIERLLKMLQLVEESFSRKKSGFTVHEASTALNC
SREEFTRDYLTTFPVRFQVLKLYQRAKHVYSESLRVLKALKMMTSATFHTDEDFFTDFGR
LMNESQASCDKLYECSCIETNQICSIALANGSFGSRLTGAGWGGCTIHLVPSGANGNVEQ
VRKALIEKFYNVRYPDLTDEELKDAIIVSKPALGTCLYEQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaacgttccaatattcagttctccggtcagagatttaccaaggtctttcgaa
caaaaacatttagcggttgtagatgcatttttccaaacataccatgtcaaacctgatttt
atcgctaggtctcctggcagagtaaatctgattggtgagcatatagattattgcgatttt
tcagttttgccattagccattgatgtggatatgctttgcgcagttaaaattttagacgaa
aaaaatccatccattaccttaacaaatgcggaccctaaatttgctcagcgaaagtttgat
ctgcctttagatggttcctacatggccatagatccgtctgtgtcggaatggtcgaattac
tttaaatgcggactacatgtggcacattcatacttgaaaaaaattgctccggaaagattt
aataatacacccttagtaggtgcgcagatcttttgccagagcgatattcctactggtggt
ggactctcatctgcatttacttgcgcggcagcactagccacaattagagccaatatggga
aaaaattttgatatttccaaaaaagacttgacccgcatcacagcggttgctgagcactat
gttggagtcaataatggtggtatggatcaagcaacgtctgtttatggggaagaagatcat
gctctatacgtagagtttaggccaaaactaaaggccacacctttcaagtttcctcaattg
aaaaatcatgaaatcagtttcgtcatcgccaatactcttgtaaagtctaataaattcgaa
actgctcctacaaattacaatttaagagtaatagaggtaacagttgctgccaacgccttg
gcgaccagatacagcgtggccttaccatctcacaaggacaattctaactcagaaagaggg
aatctaagagattttatggatgcttactacgccagatacgaaaaccaagcccaaccatgg
aatggagatatcggaactggtattgaacgtttactcaagatgctacaattggtagaagaa
tctttctcgaggaaaaagagcggattcactgtacatgaagcctctacggcgctaaactgt
tcacgtgaggagttcactagagattacctgacaacttttcccgtccgcttccaagtcttg
aaactatatcaaagagctaaacacgtttactccgaatccttaagggtgcttaaggcttta
aaaatgatgacaagtgccacttttcacacggacgaagatttctttacagattttggccga
ctaatgaatgagtcccaggcctcttgtgataaactttatgaatgttcgtgcatagaaacc
aatcaaatatgctcgattgccctagcaaatggttctttcggctcccgtctcactggcgct
ggttggggcggttgcactatccaccttgttcctagtggcgctaatgggaacgtggaacag
gtacgaaaagcactaatcgaaaaattctacaatgtaagatatccggatctcacagatgaa
gaactaaaagacgcaattatagtttcgaagcctgccttgggtacttgtttgtacgaacaa
taa

DBGET integrated database retrieval system