KEGG   Saccharomyces cerevisiae (budding yeast): YDR011WHelp
Entry
YDR011W           CDS       T00005                                 

Gene name
SNQ2
Definition
(RefSeq) ATP-binding cassette transporter SNQ2
  KO
K08712  ATP-binding cassette, subfamily G (WHITE), member 2, SNQ2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YDR011W (SNQ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDR011W (SNQ2)
Transporters [BR:sce02000]
 ABC Transporters, Eukaryotic Type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    YDR011W (SNQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane ABC_tran PDR_CDR ABC2_membrane_3 ABC_trans_N RsgA_GTPase AAA_21 AAA_16 SMC_N AAA_22 MMR_HSR1 AAA_29 TrpP cobW AAA_18 AAA_25 AAA_24 AAA_28 TsaE Dynamin_N
Motif
Other DBs
NCBI-GeneID: 851574
NCBI-ProteinID: NP_010294
SGD: S000002418
UniProt: P32568
Position
IV:465919..470424
Genome map
AA seq 1501 aa AA seqDB search
MSNIKSTQDSSHNAVARSSSASFAASEESFTGITHDKDEQSDTPADKLTKMLTGPARDTA
SQISATVSEMAPDVVSKVESFADALSRHTTRSGAFNMDSDSDDGFDAHAIFESFVRDADE
QGIHIRKAGVTIEDVSAKGVDASALEGATFGNILCLPLTIFKGIKAKRHQKMRQIISNVN
ALAEAGEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGEVAYDGIPQEEMMKRYKADVI
YNGELDVHFPYLTVKQTLDFAIACKTPALRVNNVSKKEYIASRRDLYATIFGLRHTYNTK
VGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLLKS
TAFVTIYQASENIYETFDKVTVLYSGKQIYFGLIHEAKPYFAKMGYLCPPRQATAEFLTA
LTDPNGFHLIKPGYENKVPRTAEEFETYWLNSPEFAQMKKDIAAYKEKVNTEKTKEVYDE
SMAQEKSKYTRKKSYYTVSYWEQVKLCTQRGFQRIYGNKSYTVINVCSAIIQSFITGSLF
YNTPSSTSGAFSRGGVLYFALLYYSLMGLANISFEHRPILQKHKGYSLYHPSAEAIGSTL
ASFPFRMIGLTCFFIILFFLSGLHRTAGSFFTIYLFLTMCSEAINGLFEMVSSVCDTLSQ
ANSISGILMMSISMYSTYMIQLPSMHPWFKWISYVLPIRYAFESMLNAEFHGRHMDCANT
LVPSGGDYDNLSDDYKVCAFVGSKPGQSYVLGDDYLKNQFQYVYKHTWRNFGILWCFLLG
YVVLKVIFTEYKRPVKGGGDALIFKKGSKRFIAHADEESPDNVNDIDAKEQFSSESSGAN
DEVFDDLEAKGVFIWKDVCFTIPYEGGKRMLLDNVSGYCIPGTMTALMGESGAGKTTLLN
TLAQRNVGIITGDMLVNGRPIDASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQHL
PDSEKMDYVEKIIRVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEP
TSGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLRKGGQTVYFGDIG
KNSATILNYFERNGARKCDSSENPAEYILEAIGAGATASVKEDWHEKWLNSVEFEQTKEK
VQDLINDLSKQETKSEVGDKPSKYATSYAYQFRYVLIRTSTSFWRSLNYIMSKMMLMLVG
GLYIGFTFFNVGKSYVGLQNAMFAAFISIILSAPAMNQIQGRAIASRELFEVRESQSNMF
HWSLVLITQYLSELPYHLFFSTIFFVSSYFPLRIFFEASRSAVYFLNYCIMFQLYYVGLG
LMILYMSPNLPSANVILGLCLSFMLSFCGVTQPVSLMPGFWTFMWKASPYTYFVQNLVGI
MLHKKPVVCKKKELNYFNPPNGSTCGEYMKPFLEKATGYIENPDATSDCAYCIYEVGDNY
LTHISSKYSYLWRNFGIFWIYIFFNIIAMVCVYYLFHVRQSSFLSPVSILNKIKNIRKKK
Q
NT seq 4506 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcaaaagcacgcaagatagctctcataatgctgtcgctagaagctcaagc
gcttcttttgcagcttcagaagaatcatttacgggcataacccatgacaaagatgagcag
agcgataccccggcggataaactaacaaaaatgctgacaggacctgcaagagacactgcg
agccagattagtgccactgtgtctgaaatggcgccagatgtcgtatctaaagtggagtca
tttgcagatgcactatcccgtcatacaacgagaagcggtgcctttaatatggattcagat
agtgacgatgggttcgatgcccatgccatctttgaaagttttgtaagagacgctgatgag
caaggcatccatatccgcaaggctggtgttaccatagaggacgtaagcgctaaaggtgtg
gatgcgagtgccctagaaggtgctacctttggtaacattctttgtttaccgttgaccatc
tttaaaggtattaaggctaagaggcatcaaaagatgagacagatcataagcaatgtcaat
gccctggcagaagcgggtgaaatgattttggttcttggaaggcctggtgctggttgttcc
tcctttttaaaagtaacagctggtgaaatagatcagtttgccggtggtgtttccggtgaa
gtagcatatgatggtattccccaagaagaaatgatgaaacgatataaagcagatgttatt
tacaatggtgagttggatgttcatttcccttatttaacagttaagcaaactttggatttc
gctattgcctgcaaaacgcctgctctcagagtcaataacgtttccaaaaaggaatacatt
gcatccagaagagatttatatgcaaccattttcggtctaaggcatacctataataccaaa
gttggtaacgatttcgttagaggtgtatctggtggtgaacgtaagcgtgtttccattgcc
gaggctttggcagccaaaggttccatttactgttgggataatgccactagaggtttggat
gcgtctacggccttagaatacgcaaaagccatccgtattatgacaaacttattgaaatca
accgcttttgttacaatttatcaggcaagtgaaaacatttacgaaacatttgataaagtc
actgtcctttattctggtaagcaaatttattttggtttgatccacgaggcaaaaccttat
ttcgcaaaaatgggttatttgtgtcctccaaggcaagcaacagctgaatttttaaccgcg
ttgactgatccaaatggattccatctgatcaagccaggttatgaaaataaagtaccaaga
accgctgaggaattcgaaacatattggttaaattctccagagtttgctcaaatgaaaaaa
gatatcgctgcttataaagagaaggtcaataccgaaaagactaaagaagtttatgacgaa
tcgatggctcaagagaaatccaaatatacgagaaagaagtcttattatacagtgtcatat
tgggaacaagttaaactgtgtacccaacgtgggttccaaagaatttacggtaacaagagt
tatacagtcatcaatgtctgctctgcaataattcaatcttttattactggatcattattt
tacaataccccttcatccacttccggtgctttttcaagaggtggtgtgttgtattttgcg
ctactatattattctttgatgggactggcgaatatttcttttgaacataggccaatctta
caaaagcacaagggctattctttgtatcatccttcagctgaggcaattggctccactctg
gcatctttccccttcagaatgattggtttgacctgtttctttatcattttattcttccta
tctgggttgcacagaacagcgggatcattttttaccatctatttgttcttaaccatgtgt
tcagaggcgatcaatggtttatttgagatggtttcttcagtatgtgacactctttctcaa
gctaactctatctcgggtattctgatgatgtctatctcaatgtactctacctatatgatc
caattgccttcgatgcatccatggtttaaatggatatcgtacgtactacctatcaggtac
gccttcgagtcgatgttaaatgccgaatttcacggtaggcatatggattgtgctaacact
ctagtacccagtggaggagactatgataatttatccgatgactacaaagtatgtgctttt
gttggttcgaaaccaggtcagtcttatgtgcttggtgatgactaccttaaaaatcaattt
cagtacgtttataagcacacgtggagaaactttggtatcttgtggtgctttttactgggt
tatgttgttttgaaagtgatattcacagaatataagaggcctgtgaaaggtggtggtgat
gctcttatcttcaagaaaggatcaaaaagatttatcgcacatgcagatgaagaatctcca
gacaatgtcaatgatatagatgccaaagagcaattctccagtgaaagtagcggcgcaaat
gatgaagtatttgatgatttagaagccaaaggtgttttcatttggaaggacgtatgcttt
actattccatatgaaggcggtaagagaatgcttttggataatgtttcaggttattgtatt
ccaggtaccatgacggccttgatgggagagtcaggtgctggtaaaacaactttgttaaat
actcttgctcaaagaaatgtcggtatcattactggtgatatgcttgtcaatggacgtccc
attgatgcgagtttcgaaaggcgtacaggttatgtacaacaacaggatatacatatcgca
gagttaactgttagggaatcgttgcagttttctgctcgtatgcgtcgccctcagcatttg
cctgattctgaaaaaatggattatgtggaaaaaatcatcagagttttgggaatggaagag
tatgcggaagcccttgttggtgaggttggttgtggtttaaacgttgaacagagaaagaag
ctgtctattggtgttgaactagtcgccaaaccagacttattattattcctcgatgaacct
acatcaggtttggattctcaatcttcatgggccattattcaattattaagaaagttatca
aaagctggccaatccattctttgtacgatccatcaaccttcagctactctgttcgaagag
tttgatagattactacttttgaggaagggtggacaaactgtttatttcggagatattggt
aagaactctgccaccattttgaactactttgaaaggaatggggcaagaaaatgtgattct
agtgaaaatcctgctgaatatattttagaggctattggtgccggtgccacagcatccgtc
aaagaagactggcacgaaaaatggttgaactctgtcgagtttgaacaaacaaaagaaaaa
gtacaggatttaataaatgatttatcgaaacaagaaactaaatccgaagttggagacaaa
ccttccaaatatgctacttcttatgcttaccagttcagatatgttttaatcagaacctct
acttcattttggagaagtctgaattacatcatgtcaaagatgatgctaatgctggttggt
ggtctgtatattggtttcacatttttcaatgttggtaaaagttatgtcggcttacaaaat
gcgatgttcgcggcatttatctctattatcttgtctgctcctgcaatgaaccaaatccaa
ggacgtgctattgcctccagagaactttttgaagttagggaatcccaatctaacatgttt
cactggtcgctggtgttgatcactcagtacttgagcgaacttccctatcatttatttttt
tcgacaattttctttgtctcatcgtattttccattaagaatcttcttcgaagcgtcaaga
tctgcggtgtactttttgaattactgcattatgttccagttatactatgttggtcttggc
ttaatgatcctatatatgtcaccgaaccttccatccgctaatgttatcttaggtttgtgt
ctgtcatttatgctttctttctgtggtgttacacaacctgtctcattgatgcctggcttc
tggacattcatgtggaaggcttccccatacacatattttgttcagaatctggtcggaatt
atgctgcacaaaaaaccagtcgtatgcaaaaagaaagaactaaactacttcaacccacca
aacggctcaacgtgtggagagtacatgaaaccctttttggaaaaagctactggttacatc
gaaaatcctgatgctacgtcagattgtgcatactgtatttacgaagttggagataattat
ttgacacatatcagctctaagtatagctacttgtggagaaattttggaatattttggatt
tacattttcttcaatatcattgctatggtttgtgtgtattacctcttccatgtaagacaa
tcttccttcctaagccccgtatctatactcaataaaattaaaaacataaggaaaaagaag
cagtaa

DBGET integrated database retrieval system