KEGG   Saccharomyces cerevisiae (budding yeast): YDR013WHelp
Entry
YDR013W           CDS       T00005                                 

Gene name
PSF1, CDC101
Definition
(RefSeq) DNA replication protein PSF1
  KO
K10732  GINS complex subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Module
sce_M00286  GINS complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YDR013W (PSF1)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   GINS complex
    YDR013W (PSF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sld5 PIF1 Occludin_ELL
Motif
Other DBs
NCBI-GeneID: 851576
NCBI-ProteinID: NP_010296
SGD: S000002420
UniProt: Q12488
Structure
PDB: 

Position
IV:473157..473783
Genome map
AA seq 208 aa AA seqDB search
MYGDLGNKLVLEAKRTKQLYARSNQDVNLPMYHEDIIRNILKEVSNLRKNTEYLKEQQQL
GMLDDKVAKCQYFVTLLCMERNKRCLLAYQRLRTDILDSMAWNNNGLDLMSSITFSQQDT
NNLSHQEQEYLKEYCDLITDLKSGDLVDIDLSGSLVPPSDVFIDVRVLKDAGEIQTEYGV
FNLIKDSQFFVRQSDVERLIQQGYLQKI
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtatggagatttaggtaataaattagtattagaagctaaaagaacaaaacagctgtac
gcaagaagtaatcaagatgttaatttacccatgtatcatgaagatataatacgaaatatt
ctgaaagaagtttcaaatttacgtaaaaatacggaatatcttaaagaacagcagcaacta
ggaatgctagatgataaggtggctaaatgccagtatttcgttaccttgttatgtatggaa
aggaacaagagatgtctcttagcataccaaaggttgagaacagacatactagattctatg
gcttggaataataatggtctggacttgatgagtagcattacgtttagccaacaagacaca
aataacctttctcatcaagagcaggaatatttgaaagaatactgcgatttaattactgat
ttaaaaagtggtgacttggtcgatattgatttatccggctctttagtgcctccgagcgat
gtatttattgatgttagagtgctcaaagatgctggtgagattcaaactgaatacggcgtg
tttaaccttattaaagactcccagtttttcgtaaggcagtctgatgtagagcgtttgatt
caacaaggttatttgcagaagatatga

DBGET integrated database retrieval system