KEGG   Saccharomyces cerevisiae (budding yeast): YDR016CHelp
Entry
YDR016C           CDS       T00005                                 

Gene name
DAD1
Definition
(RefSeq) Dad1p
  KO
K11553  DASH complex subunit DAD1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR016C (DAD1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Mis6 complex
     YDR016C (DAD1)
    DASH complex
     YDR016C (DAD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DASH_Dad1
Motif
Other DBs
NCBI-GeneID: 851579
NCBI-ProteinID: NP_010299
SGD: S000002423
UniProt: Q12248
Position
IV:complement(478474..478758)
Genome map
AA seq 94 aa AA seqDB search
MMASTSNDEEKLISTTDKYFIEQRNIVLQEINETMNSILNGLNGLNISLESSIAVGREFQ
SVSDLWKTLYDGLESLSDEAPIDEQPTLSQSKTK
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgatggctagtacatccaatgatgaagaaaagttgatatcaaccactgacaaatacttc
atcgagcagaggaatatagtattgcaggagatcaatgagactatgaattcaatcttgaat
ggtctgaatggtctcaatatatcattggagagctcgatagctgtgggaagagaattccag
tcagtttctgatttgtggaaaacactttatgatgggttggaaagtttatcagacgaagcg
cccatcgacgagcaacctactttatctcaatcgaaaacgaagtaa

DBGET integrated database retrieval system