KEGG   Saccharomyces cerevisiae (budding yeast): YDR019CHelp
Entry
YDR019C           CDS       T00005                                 

Gene name
GCV1, GSD1
Definition
(RefSeq) glycine decarboxylase subunit T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00260  Glycine, serine and threonine metabolism
sce00630  Glyoxylate and dicarboxylate metabolism
sce00670  One carbon pool by folate
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YDR019C (GCV1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YDR019C (GCV1)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    YDR019C (GCV1)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     YDR019C (GCV1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C Av_adeno_fibre
Motif
Other DBs
NCBI-GeneID: 851582
NCBI-ProteinID: NP_010302
SGD: S000002426
UniProt: P48015
Position
IV:complement(484163..485365)
Genome map
AA seq 400 aa AA seqDB search
MSIIKKIVFKRFNSTLKKTALHDLHVSLGGTMVPYAGYSMPVLYKGQTHIESHNWTRTNA
GLFDVSHMLQSKLSGPHSVKFLQRVTPTDFNALPVGSGTLSVLLNPQGGVVDDTIITKEN
DDNEFYIVTNAGCAERDTEFFHDELQNGSTLDCQWKIIEGRSLLALQGPKAKDVLEPLLS
KTAPGKDLKELFFGQRHEFALKDGSLVQIARGGYTGEDGFEISIANEKAVEFAEQLLANP
VMKPIGLAARDSLRLEAGMCLYGHELDESITPVEAALNWVISKSRRDLVDQKYWFNGYAK
IMDQLNNKTYSKVRVGFKYLKKGPAARNGVKIFLPDAETEVGLVTSGSASPTLNNINIGQ
AYVQKGYHKKGTKLLVQVRNKFYPIELAKMPLVPTHYYKQ
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtctataatcaaaaaaattgtgtttaagagattcaactcaactttgaaaaaaactgct
cttcatgaccttcatgtgtcattaggcggtacaatggtaccatacgcaggatattccatg
cccgtactatacaagggacagactcatattgaatcacataattggaccaggacaaacgct
ggtttatttgatgtttctcatatgttacaaagtaagttatctggtcctcattctgttaag
tttctgcaacgtgtaacgcccacagatttcaatgccttgcctgttgggtcagggacctta
agtgttctattaaatccacagggaggcgtggtagacgataccatcatcactaaagaaaac
gatgacaatgagttctatattgtgaccaatgctggctgtgcggaaagagacaccgagttc
tttcacgatgagctacaaaatggttctactttagattgtcaatggaaaatcattgaaggt
agatcactattggcattgcagggtcctaaagcaaaagatgtgttggaaccacttttatca
aaaacagctcctggaaaggatctaaaagagttattttttggacaaagacatgaatttgcg
ttaaaggacggttctttggttcaaattgctagaggcgggtacactggtgaagatggattt
gagataagcattgcaaatgagaaagcggttgagtttgcggagcaactcttggccaatcca
gtaatgaagcctatcggactggctgctagagacagtttaaggttggaagctggtatgtgt
ttgtatggtcatgaattggacgaaagtatcacaccagtagaagctgcgttaaactgggtg
atttcaaagtcaagaagggacctagtagatcaaaagtactggttcaatggctatgccaag
ataatggaccagctaaacaataaaacgtatagcaaggtacgagtcggattcaaatacttg
aaaaaggggccagctgccagaaatggtgtcaagatcttcttgcccgatgccgaaacagag
gtcggccttgttacatcaggtagtgcatctccaactttaaacaacatcaatattggacaa
gcttatgtacagaaaggttaccacaagaagggaacgaagttgcttgttcaagtaaggaac
aagttctacccgattgaacttgctaaaatgcctcttgtgcccacacattactacaagcag
taa

DBGET integrated database retrieval system