KEGG   Saccharomyces cerevisiae (budding yeast): YDR020CHelp
Entry
YDR020C           CDS       T00005                                 

Gene name
DAS2, RRT3
Definition
(RefSeq) putative uridine kinase DAS2
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00240  Pyrimidine metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YDR020C (DAS2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     YDR020C (DAS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK
Motif
Other DBs
NCBI-GeneID: 851583
NCBI-ProteinID: NP_010303
SGD: S000002427
UniProt: Q12084
Position
IV:complement(485746..486444)
Genome map
AA seq 232 aa AA seqDB search
MDRKAVEEKRIVISIGGGHATGVGAIALDLQNTFKSLYNSINIRVINLDNMIEGNIKSYN
NNDYDFDNILNLVYEKHAVTSQNDMIQHDYEDPIDLIIVCGCYALYDKRINEISQLKVFL
DSDADKRLISLIKKKNVGSNEQLAQLITEYMDHLRPEMQQYIEPTRTFADLIIPSTNENL
GRAVLVDGIVKAIEDTKSQIEGNNTNNKIRPRLWDFEAETMDLEKDRYYDLS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggacagaaaagctgtcgaagaaaaaagaattgttatttctatcggtggagggcatgct
actggtgttggagcaattgcactggatttacaaaatactttcaaaagcctatataactct
atcaatataagggtaataaacctagataatatgatagaagggaacatcaagagctacaat
aataacgactatgattttgataatatccttaatttggtatatgaaaagcacgctgtaact
tctcaaaatgacatgattcaacatgattacgaggacccgatagatttgataatagtatgt
ggctgttatgcgctatacgataaacgcatcaacgaaatatctcaattaaaagtattcttg
gatagtgatgcagataaaagattaattagtctaatcaagaagaagaacgtagggagcaat
gaacaactagcccagttgatcactgagtatatggaccatctgcgcccggagatgcaacaa
tatatagagcccactagaacttttgcagatttgatcattccttctacaaatgaaaatcta
gggcgcgcagtcctcgtggacggtatagttaaagcaatcgaagataccaaaagccaaata
gaaggcaacaatacgaacaacaaaatacgcccacgtttatgggatttcgaagctgaaaca
atggacttggagaaagatagatattacgatctgtcatga

DBGET integrated database retrieval system