KEGG   Saccharomyces cerevisiae (budding yeast): YDR027CHelp
Entry
YDR027C           CDS       T00005                                 

Gene name
VPS54, CGP1, LUV1, TCS3
Definition
(RefSeq) Vps54p
  KO
K17600  vacuolar protein sorting-associated protein 54
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YDR027C (VPS54)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDR027C (VPS54)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YDR027C (VPS54)
Membrane trafficking [BR:sce04131]
 Endosome - Golgi transport
  Tethering complex
   GARP complex
    YDR027C (VPS54)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Vps54 DUF1759
Motif
Other DBs
NCBI-GeneID: 851591
NCBI-ProteinID: NP_010310
SGD: S000002434
UniProt: Q12071
Position
IV:complement(494649..497318)
Genome map
AA seq 889 aa AA seqDB search
MSISETPHNKSQGLQKAAGRPKIVVPEGSPSRNSDSGSFTIEGDTSLNDDLLSISGSVTP
RARRSSRLSLDSITPRRSFDSRTLSVANSRSFGFENETHSGSMDFSPLGNNSIYEIVMNT
RRKNWLNYPTVADIPQVSLSKNDLDDHWKTHVIEYVKNIKSDYQIFQSTNNIRNMNQMEQ
LKELREGENMHEESFEANLRQGDAELINSIPDFYFSDKFQLDNPRTFHKVLDAIDLFLTK
LDMKRQAERDEAFSELRDRLNDFLDIVETLLVTEISKSSHKFFHALSEVDNIQKRALDTM
SELKELAQNIKTIDAENIRKKISHLEMIFKRKNVEKLEQGLLQAKLVLNKTDECKSMYEE
NKLDNCLELIKSIDYLIKGDDSINEDVQSWTRCWPYKLSNLRTIPALSATREFLTNMKIE
IGGKFSLQLSILLIDDLRSFCKSIKPKETLHRIQTGSNDKKQTIFTDNFSSKITELIVRL
NRCEELTSAFDLYREKSITELKSIIKIYLPTENAHADNNHDEKHLNNGSTSGSKLSRLIK
EQTPAEFQSMLVNIFTHALEALRRLYGHQKLLLDISLNELASVKSPNENQHNMITQLDIR
TGINEIIRIIQLRTGKIIAVRRELNLSLRYDYFLKFYAICVIFIQECEVLSGEFLTKYLS
NVLASQIKHYANAQSSKNYRNIKKKIDAEEWIPYIVDSSIQSDVNDIVSSIDIDPLSWTT
ILDMVGGSHDCENGRSEDKEKDEGNETYQGHRKSVVVGDKTFVASSSLLATIEVIKELMV
LSINLPSIYLSNFEKLCYDALQYYNSSAMASVTQPGNSLLKTGRNLSIMGESLDCLAEFV
IIVQRFYQRLSNSNRDFEPFDASHYTTLLGQFQASSNKIYMANAPPPPV
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataagcgaaacacctcataataaaagccagggactgcaaaaagcggctggtcgt
cctaaaattgttgttcctgagggatcgccttctcgtaatagtgatagtggctcttttact
atagagggtgatacttcccttaatgacgacttgttaagtatatctggcagtgtcacacca
agagcgagaagatcttcgagattaagtctggattcaataacgccgcgaagaagttttgat
tctaggacactatctgttgcaaatagtagatcattcggttttgaaaatgaaacacatagt
gggtccatggacttttcgccattgggaaataactccatctatgaaattgtgatgaacaca
aggaggaaaaactggctcaattaccccactgttgctgatattccacaagttagcctaagc
aaaaatgatctggatgaccattggaaaactcatgttatcgaatacgtcaaaaacattaaa
agtgattaccaaatatttcaaagcacaaataatataagaaacatgaatcagatggaacag
ttaaaagaactgcgagaaggggaaaatatgcatgaggagtcgtttgaagcaaatctgagg
caaggggatgccgagctaataaatagtatacctgacttttacttttcagacaaatttcaa
ttagataaccctcgaacttttcataaagtgttggacgctatcgatttatttttaacgaaa
ctagacatgaagagacaagcggaaagggatgaggctttttctgagttgagggacaggcta
aacgattttttggatatcgtagaaacattactggttacagagatatccaaatcctcacac
aaattttttcatgcgctaagtgaagttgacaatattcagaaaagagccttggacacaatg
agcgagcttaaggagctagcacagaatatcaagaccattgacgcagagaatataagaaaa
aaaatttcacatttagaaatgatttttaagaggaagaatgtagagaaactagaacaggga
ttattacaggcgaagttagtgctgaacaaaacagatgagtgtaagtcaatgtatgaggag
aacaagttggataactgcttagagctgataaaatccatcgattatctgattaagggggat
gattcaataaacgaagatgttcagagttggactaggtgttggccctataaattaagcaat
ttgaggacgatacctgctttgtcagcaacgagagagtttttaaccaatatgaagattgaa
ataggaggaaagttcagcctacaattatcgattttactaatagatgatttaagatccttt
tgcaaatcaatcaaaccaaaggaaacactacataggatacaaacgggatctaatgataaa
aagcaaactatatttactgataatttttcttcaaagataaccgaattaatagtcagattg
aatagatgcgaagaattaacgagtgcctttgacctatacagggaaaaatctatcactgag
cttaaatctatcataaaaatttatttgccaacagagaatgcacacgctgacaataaccac
gatgaaaaacatcttaacaatggctctactagtgggtctaaactttcaagattaataaag
gagcaaactcctgcagaatttcagtccatgctagtaaacatattcacgcacgcgctcgaa
gctcttcgaagactttatgggcatcaaaagttgcttctagatatctctcttaacgagcta
gcatctgttaaaagtccaaacgaaaaccagcacaacatgattacgcaattggatatacgt
actggcatcaacgaaataatcagaattattcagttacgtacaggcaagatcattgccgta
agaagagaattgaacttatctctacggtatgattatttcttgaaattttatgctatatgc
gttatttttattcaagaatgtgaagtattaagtggtgaatttttaacgaaatatttaagt
aatgttttagcatctcagatcaagcattatgcaaacgcacaaagttcaaaaaattaccgc
aacataaagaaaaagattgatgctgaagaatggattccatatattgtggactcctctatt
cagagcgatgttaacgacattgtgtcaagtatagacatagacccattgagttggacaact
attttagacatggtagggggttctcatgattgcgaaaatggcagaagcgaggacaaggaa
aaagatgaaggaaatgaaacatatcaaggtcataggaaatcggttgttgttggcgataaa
acttttgtggccagtagttctctgctcgctaccattgaggttattaaggagctaatggtt
ctttccataaaccttccctcgatatacttatcaaatttcgagaagttgtgctatgacgca
ctacaatactacaacagtagcgccatggcatctgtcacacaacctggaaactcactttta
aaaacgggtagaaacttatctatcatgggagagtcattggactgtctcgcagaatttgtg
attattgttcagagattttatcaaaggctttccaactctaacagggattttgagccattc
gatgcgagtcattatacaaccctgttggggcaattccaggcctcatcgaataaaatatac
atggccaatgccccacctccgcctgtataa

DBGET integrated database retrieval system