KEGG   Saccharomyces cerevisiae (budding yeast): YDR028CHelp
Entry
YDR028C           CDS       T00005                                 

Gene name
REG1, HEX2, PZF240, SPP43, SRN1
Definition
(RefSeq) protein phosphatase regulator REG1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1752 DUF5428
Motif
Other DBs
NCBI-GeneID: 851592
NCBI-ProteinID: NP_010311
SGD: S000002435
UniProt: Q00816
Position
IV:complement(497835..500879)
Genome map
AA seq 1014 aa AA seqDB search
MSTNLANYFAGKKDIENEHVNRNASHESNSKSDVKISGNDNDNDEDMGPSVSMAVQAKND
DDFHKSTFNLKRTRSMGLLDEYIDPTKKLLGRSDDLYDNDNEYYDNSSNNSSSNSSDDDY
DDGYQEHSTSVSPPPADNDSYLIPQDDNDVVVEPERHVDYLSHEWKESEISNSWKYIILK
KKKRDVDLVNAARLENASWRTWAKARNNLKTVSPEVVNWSKDSDVTWLYGPIVRDSEGNA
QSEEEHDLERGYGSDDENSKRISMPTKNSKSIAAAPKPILKKRTVTEIIEDNALWKLNEA
RKHMTEMKHASVIMDPNGNKNVHDDFDALAAQVNAQYYHYPKESNSSVSLKSQHSDKKDN
STIPNPVGENSNGGGDKGEEDLHLKSALHVQNNRSTAQSNKSILENSTNDRKANLDQNLN
SPDNNRFPSSTSSSNRDNENNSMGLSSILTSNPSEKSNKPTKNRHIHFNDRVEQCMALRY
PASQSEDDESDDENKQYVDVNNNANVTTINNNRTPLLAIQHKSIPINSATEHLNKNTSDD
DTSSQSSSSSHSDDEEHGGLYINARFSRRSDSGVHSPITDNSSVASSTTSRAHVRPIIKL
LPDTTLNYGSDEESDNGEFNGYGNAVSHNVNTSRGYDYIYDYNSVYTGDTSSFLPVDSCD
IVDVPEGMDLQTAIADDNASNYEFNNAVESKEKHVPQLHKASANNTTRQHGSHMLLYDDD
NYSSSSDSEQQFIEDSQYNSSDDEEEEDDDDQEVDDNHDEGLSLRRTLSLGKSGSTNSLY
DLAQPSLSSATPQQKNPTNFTGGKTDVDKDAQLAVRPYPLKRNSSSGNFIFNSDSEEESS
SEEEQRPLPANSQLVNRSVLKGSVTPANISSQKKKALPKQPKASDSSQSFRIVNNTPSPA
EVGASDVAIEGYFSPRNESIKSVVSGGNMMDHQDHSEMDTLAKGFENCHINNASKLKDKK
VDSVQTTRKEASLTDSSNESLHKVVQNARGMASKYLHSWKKSDVKPQENGNDSS
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaatctagcaaattacttcgccggtaagaaagatattgaaaacgagcatgta
aatagaaatgcgagccatgaaagtaatagcaaaagtgatgtcaaaattagtggtaacgat
aacgacaacgacgaagatatggggccttcagtatcgatggctgttcaagcgaaaaatgat
gatgatttccataaatcaactttcaaccttaaaagaacaagatcaatgggccttcttgat
gaatatattgaccctaccaagaaattgctaggaaggtcagacgacttatatgataacgac
aatgaatattatgacaactcatctaataattcttcaagcaattcttcagatgatgattat
gatgacggctatcaggaacactcaacctccgtttctccaccgccggcggataatgatagc
tacttaattccacaagatgataatgacgtagtggtagagccagaaagacatgttgactat
ctgtcacatgaatggaaagaatcagaaatttctaattcttggaaatatatcatcctaaag
aaaaagaaaagagatgttgatctagtaaatgctgctaggttagaaaatgcctcatggaga
acatgggcaaaagcaagaaacaacttgaaaacagtgtcacctgaagtggttaattggtca
aaagattctgatgtgacttggctatatggccctattgtaagagattctgaaggtaatgcc
caaagtgaagaagaacatgatctagaaagaggatatggttcggatgatgaaaattccaag
agaatttcaatgcccactaaaaattcaaagtcgatcgcagctgctccgaaaccaattttg
aagaagagaaccgtcacagaaattatagaggacaacgctttatggaaactgaatgaggca
agaaaacacatgacagaaatgaaacatgcttcggtaataatggatcccaatggcaacaaa
aacgtccatgacgatttcgatgctctggccgctcaagttaacgcccagtactaccattat
cccaaagaatcgaacagtagcgttagtttgaagagtcaacactctgacaaaaaagataat
tctaccataccgaatcctgtaggagaaaattcaaatggtggcggtgacaagggagaagaa
gacctgcatttaaagtcagcgcttcatgttcaaaacaataggtcaacggcacaatcaaac
aaaagcatactagaaaatagtaccaatgatcgtaaggctaacttggatcaaaacctaaat
tctcctgataataataggttcccctcctcaacatcttcctccaatagagataatgaaaac
aattccatgggattatcatcaatattaacctcaaacccaagtgaaaaatctaacaaacct
actaaaaatagacatatacattttaatgacagggtggaacaatgtatggcactacgatat
ccagcttcacaatcggaggatgatgaaagcgatgatgaaaataaacaatatgttgatgtt
aataacaatgcgaacgttacaacaataaacaacaataggactccattgctagccattcag
cataaatctattcctatcaactccgcaactgaacatttgaacaaaaatactagcgacgat
gatacatcctcacaatcatcatcttcatcacattctgatgatgaagaacacggcggcctt
tacataaatgcaagattttccaggaggtctgactctggagttcattcaccaataacagat
aattcctctgtggcttcatctactacttccagagctcatgtacgtcccataataaagttg
cttcctgataccactttgaattatggatcagacgaagaatctgataatggcgaatttaat
gggtatggtaatgctgtgtcacataacgtcaatacctccagaggctatgattacatatac
gattataactcggtctacactggtgatacttccagttttttaccagtagattcatgtgac
attgtagatgttcctgaaggaatggacttacaaacagccattgcagatgataatgcatca
aactatgaatttaacaatgcggtagaatccaaggaaaaacatgttccacaactacacaaa
gcttcagcaaataatacaacacgtcaacatggatcgcatatgttattatatgacgacgac
aattacagctcttcatcagatagcgaacagcaatttattgaagactcacaatacaatagt
agcgacgacgaagaggaagaagatgacgatgaccaagaagtagacgataaccacgatgaa
ggactttcactgaggagaacattgtcacttgggaaatcaggatctaccaattctttgtac
gatctagcacaaccatcactctcttcggcaactcctcaacaaaaaaatcctactaatttt
acagggggtaaaactgatgtagacaaagatgcacaactggctgtcaggccgtatccgttg
aagcgcaattcctcttcagggaacttcatattcaattcagatagtgaagaagagagtagc
agcgaggaggaacaaagaccattacccgctaacagtcagctggttaatcgaagcgtattg
aaaggcagtgtgacaccagcaaacatatcatctcagaagaaaaaagcccttccaaagcag
ccaaaagcgtccgatagttcacaaagctttagaattgtaaataatactccttcaccagcc
gaagtgggggcgagtgatgttgccatagagggttatttctctcctagaaatgaatctatc
aagtctgttgtttccgggggaaatatgatggaccatcaagatcactcagaaatggacact
ttggcaaaaggatttgaaaactgccatataaataatgctagtaagctaaaggacaagaaa
gttgatagcgtgcaaaccactagaaaagaagcgtctttgacggattcgagtaatgaaagc
ttacacaaagtggtgcagaatgcaagaggtatggcaagcaagtacttgcactcttggaaa
aagagtgacgtcaagccacaagaaaatggaaatgacagcagttag

DBGET integrated database retrieval system