KEGG   Saccharomyces cerevisiae (budding yeast): YDR119WHelp
Entry
YDR119W           CDS       T00005                                 

Gene name
VBA4
Definition
(RefSeq) Vba4p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 UPF1_Zn_bind
Motif
Other DBs
NCBI-GeneID: 851697
NCBI-ProteinID: NP_010404
SGD: S000002526
UniProt: Q04602
Position
IV:688227..690533
Genome map
AA seq 768 aa AA seqDB search
MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE
NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL
KPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFERADDMPV
VQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYVENTSSDE
LVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIG
QLVFLKLSLISSVKLLLCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKST
IMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNAS
IMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEILTLTLFLLCFVQVTSLDLTGLKN
NTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCI
IPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLL
LYVALMGVSLNLPVWKQYICLSLPFLGSSMILTLLSNLYHEYHEQRKSPISGSIVYCFGA
VGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKF
VFQTLIECYLQACRNVFKLSTLFFTITVVAIFIFNRIHCRSQNCLSLS
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaggatagacagcgcaagaaactgcgtgagtttgctaaattgaaaaacagg
cagcgaaacttgagaaagagcgtgcaaacattgaagaatgaggttcaacgagaggctaaa
gtcccaagaacttcgaatcaaattgctttaggaaacgacaaaatcgaagagattaacgaa
aatagtccattattatcagctcctagtaaacaagaggaggtatcaattccgaaagcggtt
gatattgataccattgatgcacagcctcttcacgaaggcccaaaaattgatgactcgccc
caagatgaggtcaatagcattaaaggaaaacctgcggacaaggctaatgaagacgatctt
aagccgccttcacaacatgaagcatgtggaaattcagctttgcaaagctctattacagat
tttagtgatagatcagtatcaccattgcaaagtattaccagctgcaatactccgatgagt
gagcacgagctaccagtatcttcctcaaattcgtttgaaagagctgatgatatgcctgta
gtgcaggcagataaccagacgtcaagtagtaaatctttgcacattgttgcaccatctcct
gaagtaccagtcagcggagatgaaatcacttcatatggatatggctctataccccagagc
atcggggatgtagagaacggattgaatcctccttatgtcgaaaatacatcatctgatgaa
cttgtacatgatctgacgagaagacggatattttcatcctgtatgtgtacttatttattc
tttattgcaatggacagttctataatcctagtaattgcgtccaaaattgcttcggagttt
catgagttatggagattatccttagtcatctcagcatacctattgagtaatgctattggg
caactggtatttttgaagctatctttaatatccagtgtaaaattgttgttgtgtattgct
caattcagttttatccttggtggctatttatcttggagttctgcccatttttggacgttt
atctttgcccgttgtgtcacaggatttgggggcggttccttaatagcgctcaaaagtact
attatgaatcggttttctcaaaagaacgacagtcggtactcattgagtgcctctatgata
acatttgctatgggtgtggtaattgggccctttatgatgaacttgtttgattcttctcat
ggtagcgggtggagaaatgccttcttaataccagttcctttttgccttgtgaatgcctcg
attatgctggcagatatgtattctgttaagagcactttatatggacgcccaacgcctaca
ttatggaaaagattcaagaatactctattaagtcctgatttatacgaaatattgacactt
acgctattcctactttgtttcgttcaagtgacctcattggatttaacagggttaaagaat
aatacgatgattcaagcgctactattttctgtaattatcgtttgtggcattttatttttc
ttgatagagacaagcgatacttacatgaactctgtaatttcaatgtccttacaaggtgac
aagcgtttaatatggacaatgataggaatttcattttgctttgcagcattaatgtgcatc
atcccattcggtacaacgtacttcatcattgttttaaatttaagcactttacaacttgca
gagagattgtccccattctttttctccattgtactgggttactttagtgtttcttatttt
tggaagtcgaaaggacagaattttttgctaaaatttgttttaagcggagccaccctgtta
ctatatgtggcacttatgggggtaagtttgaatttaccagtatggaagcaatatatatgt
ttgtctctgccatttttgggctcctctatgatattgaccttgctgtcaaatctttatcat
gagtaccatgaacaaagaaagtcacctatcagtggttctatcgtatattgtttcggtgcc
gtgggggggacggttggtatttccttgggtggttatgtcttccacaaaacattaataaaa
cttatgcatgagaaggtgatgccatttagcaagcaaggttatcttaaaaaggaccttttg
aaaattatcaagcacgctacggaatcttcagattgggtacacgaatcagccccaaagttt
gtttttcaaactttgattgagtgttatttacaagcatgtcgaaacgtattcaaactctct
acccttttttttacgattactgtcgtagcaatattcattttcaacagaatccattgtcgt
agtcaaaattgtttgtcactatcttga

DBGET integrated database retrieval system