KEGG   Saccharomyces cerevisiae (budding yeast): YDR137W
Entry
YDR137W           CDS       T00005                                 

Gene name
RGP1
Definition
(RefSeq) Rgp1p
  KO
K20477  RAB6A-GEF complex partner protein 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDR137W (RGP1)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    YDR137W (RGP1)
SSDB
Motif
Pfam: Rgp1 DUF4606
Other DBs
NCBI-GeneID: 851714
NCBI-ProteinID: NP_010421
SGD: S000002544
UniProt: P16664
Position
IV:728259..730250
AA seq 663 aa
MRAHRIDTFLIRENIKLEIIHESNSYFGGEHISIAFRFKHLGSQHELFNYKEKLLTVDKA
VEEKLEQQAKVQDDGEGTMENQTWSLKSLLGAFKRTGEPEESVDVDNMKMLNESKMLREK
IQKQMYFHQPVTLISGYVQISGVFQYDSEVISESKFKQDEVKMVGLDIVPGHTTNSVLAL
EDGEHFKGKRNLTNYLNSDYTNVTNGLLFSESGSRGRTGTYNERTLMISNDTSIKTLPLL
LIPQTLLFSEISLEPGEVRTFYFKSTKLPKDICPSYSSSKVASINYTLEVGADVLSDDNI
EKFSNRVPITIAPYISSNAEQYTSRLDKPAIILKTGNIKELKPRLFTRKVSTASAVSFGR
RKSSIIDIDSPLEDNEFVKRVKKNFIELVESNQNVSRDIDELIDLQMGVQFGKDEDSSDP
EPNDSHFSNEMVTSAESSLRSDAVTKRRKSYSVRDNISNLEQKMWNDCSLVKSDENSNLL
PQLINLQNAYQINRNNETMAKVSLSAPFYKTTDDINLVIELDPITTPLLKVTSLTVSLES
FEIINPKYKTEGKGIGSKPKGNSVYEKHFICFDECKSVSVKLLPPRSPTNQITGQFKTDV
FQHKWMIGLKFVIIAKTESITLDQFYEDKKGILFHSKENLEGEEFTCYVPIPILCTSEDF
MGW
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgcgtgcgcacagaatcgatacatttctcataagagaaaacatcaaactggagatcata
catgaatcgaattcctattttggtggagaacatatatcaattgctttccgatttaagcac
ctaggctcacagcatgaattgttcaactataaagaaaagcttctcactgtcgataaagct
gttgaagagaagttggaacaacaagcgaaagtgcaagatgatggtgaaggcacgatggaa
aatcaaacctggtccctaaaatcattactaggtgccttcaaaagaacaggcgaacctgaa
gagagtgtggatgtggataacatgaaaatgctaaatgagagtaagatgttaagagaaaaa
atacagaagcaaatgtattttcatcaacctgtaacgttaatatccggttatgttcaaata
tcgggggtctttcaatacgattcagaggtaatttcagagtcaaaatttaaacaagatgaa
gtaaaaatggtaggactagatattgtacctggacatacgacaaattctgttcttgcattg
gaagatggagaacatttcaaaggtaaaagaaatttaaccaactacctcaactcagattat
acaaatgtgaccaatggtcttcttttctcagaaagcggttctaggggaagaacaggtacc
tataacgaacggaccttaatgatatcaaacgataccagtataaaaacattacctcttctt
ttaataccacagacgcttttattttctgaaatttctttagaaccaggtgaagtaagaaca
ttctattttaaatccacaaagctgccaaaagatatatgcccaagttattcatcgtcaaaa
gtggcatcaataaattacacgctggaggttggtgcggatgtactttctgatgataatatc
gagaaattttcaaatagagtcccaataacaatagcaccatatattagttcgaatgccgaa
cagtacacatcacgtctggataagcctgctatcatattaaagacaggtaacataaaggaa
ctaaagccacgtttgtttactcgaaaagtttctacggcttctgctgtatcatttggtagg
agaaaatcttctataattgacattgattctccattagaagataatgaatttgtcaagcgt
gtcaaaaaaaacttcattgaactggtggaatctaaccaaaatgtgtcaagagatatagac
gaacttattgacttgcaaatgggggtacagttcggaaaggatgaggattcttcggatcct
gaacccaacgactcacacttttcgaacgaaatggtgacgtctgcagagtctagcctgaga
agcgatgctgtaactaagaggagaaaaagttattcggtacgcgataacatttctaacctc
gagcaaaagatgtggaacgattgttctctcgttaagtcagatgagaattctaatcttcta
cctcagctaattaatttacagaacgcatatcaaattaacagaaataatgagactatggca
aaagtatccttatcagcacctttttataagacaactgatgatataaatttagtcattgaa
ttagatccgataacgacgcctttacttaaagtgacttcgttgactgtatccttagaatcg
tttgaaattataaatccaaaatataagactgaaggaaaaggaatagggagcaaaccaaaa
ggaaactcggtgtatgagaaacattttatttgtttcgatgagtgcaagtccgtatcggtg
aaattacttcctccaagatcgcctacaaaccagattaccggacaattcaagacagatgtt
tttcaacataagtggatgataggactaaaatttgtaataattgcaaagacagaaagtatc
actttggatcaattttatgaggataaaaagggcatcctattccattcaaaagagaattta
gaaggtgaagagtttacatgttacgttcccattccaatactgtgtacatccgaagatttc
atgggatggtaa

DBGET integrated database retrieval system