KEGG   Saccharomyces cerevisiae (budding yeast): YDR139C
Entry
YDR139C           CDS       T00005                                 

Gene name
RUB1
Definition
(RefSeq) NEDD8 family protein RUB1
  KO
K12158  ubiquitin-like protein Nedd8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDR139C (RUB1)
Ubiquitin system [BR:sce04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   YDR139C (RUB1)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD TBK1_ULD Ubiquitin_2
Other DBs
NCBI-GeneID: 851717
NCBI-ProteinID: NP_010423
SGD: S000002546
UniProt: Q03919
Position
IV:complement(join(733618..733702,733776..733924))
AA seq 77 aa
MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAH
LVEGMQLHLVLTLRGGN
NT seq 234 nt   +upstreamnt  +downstreamnt
atgattgttaaagtgaagacactgactgggaaggagatctctgttgagctgaaggaatca
gatctcgtatatcacatcaaggaacttttggaggaaaaagaagggattccaccatctcaa
caaagacttatattccagggaaaacaaattgatgataaattaacagtaacggatgcacat
ctagtagagggaatgcaactccacttggtattaacactaagaggtggtaactag

DBGET integrated database retrieval system