KEGG   Saccharomyces cerevisiae (budding yeast): YDR145WHelp
Entry
YDR145W           CDS       T00005                                 

Gene name
TAF12, TAF61, TAF68
Definition
(RefSeq) Taf12p
  KO
K03126  transcription initiation factor TFIID subunit 12
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YDR145W (TAF12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YDR145W (TAF12)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR145W (TAF12)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     YDR145W (TAF12)
   Coactivators
    SAGA/TFTC/STAGA complex
     YDR145W (TAF12)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    PCAF complex
     YDR145W (TAF12)
    STAGA complex
     YDR145W (TAF12)
    TFTC complex
     YDR145W (TAF12)
    SAGA complex
     YDR145W (TAF12)
    SLIK complex
     YDR145W (TAF12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFIID_20kDa Histone
Motif
Other DBs
NCBI-GeneID: 851723
NCBI-ProteinID: NP_010429
SGD: S000002552
UniProt: Q03761
Position
IV:746738..748357
Genome map
AA seq 539 aa AA seqDB search
MSSNPENSGVNANNNTGTGNADAITGAQQNMVLQPRQLQEMAAKFRTLLTEARNVGETTP
RGKELMFQAAKIKQVYDALTLNRRRQQAAQAYNNTSNSNSSNPASIPTENVPNSSQQQQQ
QQQQTRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEI
NKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQ
ESTQQQRVQQQRVQQQQQQQQQQQQQQQQQQQQQQQRQGQNQRKISSSNSTEIPSVTGPD
ALKSQQQQQNTITATNNPRGNVNTSQTEQSKAKVTNVNATASMLNNISSSKSAIFKQTEP
AIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKL
RELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNLEARDIQL
HLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDKVAAAKNNGNNVASLNTKK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaatccagaaaattctggtgttaatgcgaataataatacgggcactggtaac
gctgatgcgatcacaggagctcagcaaaatatggtactgcaaccgagacagttgcaagaa
atggccgctaagttcaggacattactgactgaagcaagaaatgtaggtgaaactactcct
aggggcaaggaattgatgttccaagccgcaaagatcaaacaggtatatgatgcccttaca
ctgaataggagaagacaacaggctgcgcaagcctacaataatacttcaaattcaaattca
agcaatccagcttctattcctactgaaaatgtccctaattcatcacagcaacaacaacaa
caacaacaacagacaagaaacaacagtaacaaatttagcaatatgataaaacaggttctc
accccggaagagaaccaagaatatgaaaagctatggcagaatttccaagtccgtcatacg
agtataaaggagaaagagacctacttgaaacaaaatattgataggttagaacaagaaata
aataaacagacggacgaagggcccaagcagcagctacaagaaaagaaaattgaactgctt
aacgattggaaggtgctaaaaattgagtataccaagctgttcaataattatcaaaacagt
aaaaaaacattctatgtagagtgtgcaagacacaatccggctttacataaattcttgcaa
gaaagcactcaacagcaacgagtgcagcaacaaagggtacaacaacaacaacaacaacag
cagcagcagcagcaacagcagcaacagcaacagcaacagcaacagcaacgccagggtcaa
aaccaaagaaagatttctagttctaattctactgaaataccctctgtaaccggccctgat
gcactgaaatcgcagcagcagcagcagaatacaataactgccaccaataatcccaggggc
aatgttaacacttcacagactgaacaatcgaaagctaaggtaaccaatgtaaatgcaacg
gcatctatgttgaataatataagttcgagcaaatcggcaatattcaaacaaacagagcct
gccatacccatatcggaaaatatatctaccaaaacaccagcaccggtagcttatagatcc
aacagacctacaataactggaggttctgctatgaatgccagtgctttgaatacaccagca
acaactaaattaccaccctatgaaatggatactcagagagttatgtcaaagcgtaaatta
agagagttagtgaagactgtcggaattgatgagggtgacggtgaaactgtcattgacggt
gatgttgaggaattactattggatcttgccgacgattttgttactaatgttacagctttt
tcttgtagattggcaaaacacagaaaatcggacaatttggaggcaagagacattcagtta
catttggagagaaattggaatattaggattcctggttattccgcagacgaaataagaagt
acaagaaaatggaatccctctcaaaattataaccagaaattgcagagtatcacatcagat
aaggtagcagctgcaaaaaacaatggaaacaatgttgcaagcttgaatacaaaaaaataa

DBGET integrated database retrieval system