KEGG   Saccharomyces cerevisiae (budding yeast): YDR147WHelp
Entry
YDR147W           CDS       T00005                                 

Gene name
EKI1
Definition
(RefSeq) bifunctional choline kinase/ethanolamine kinase EKI1
  KO
K00894  ethanolamine kinase [EC:2.7.1.82]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00564  Glycerophospholipid metabolism
sce01100  Metabolic pathways
Module
sce_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    YDR147W (EKI1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.82  ethanolamine kinase
     YDR147W (EKI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Choline_kinase Choline_kin_N APH EcKinase DUF1679
Motif
Other DBs
NCBI-GeneID: 851725
NCBI-ProteinID: NP_010431
SGD: S000002554
UniProt: Q03764
Position
IV:751631..753235
Genome map
AA seq 534 aa AA seqDB search
MYTNYSLTSSDAMPRTYLVGTASPEMSKKKRQSANCDKPTRRVIHIIDTNEHSEVDLKNE
LPITCTNEDGEMTSSSWTSQTANDFLKLAYVNAKLDPSLPSQYFKQDIINVLQSLEIPGW
SVPGSKESSLNKNLLTLTQIKGALTNVIYKIHYPNLPPLLMRIFGDSIDSVIDREYELKV
IARLSFYDLGPKLEGFFENGRFEKYIEGSRTSTQADFIDRDTSIKIAKKLKELHCTVPLT
HKEITDQPSCWTTFDQWIKLIDSHKEWVSNNVNISENLRCSSWNFFLKSFKNYKRWLYND
SAFTSKLLREDDKDSMINSGLKMVFCHNDLQHGNLLFKSKGKDDISVGDLTIIDFEYAGP
NPVVFDLSNHLNEWMQDYNDVQSFKSHIDKYPKEEDILVFAQSYINHMNENHVKIASQEV
RILYNLIIEWRPCTQLFWCLWALLQSGRLPQRPLIEGEKLMSEKAGLGDETHLMEHKNKE
NGKYDCSEDDSFNYLGFCKEKMSVFWGDLITLGVIDKDCPDIGKTDYLDTKLIF
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtacaccaattattcacttacaagcagtgacgcaatgccccgaacttacttggtcggc
acagcctcaccagaaatgtctaagaaaaagcgccagtctgcaaattgtgacaagccaacg
aggagggtgatccacatcatcgatactaatgagcactcagaagtcgacttgaaaaatgaa
ctgccaataacatgcacgaatgaagacggtgagatgacatcaagctcatggacttcacaa
accgctaatgattttctcaaactggcatacgtaaacgcgaaattagacccgtctttgcca
tctcaatatttcaaacaagatatcataaatgttttacaaagcttggagattcctggatgg
tctgtgcccggctctaaagaatcctcgttgaataagaatttattaactttgacacaaatc
aagggggcccttacaaatgttatttataagattcactatccaaacttaccccctttactg
atgagaatttttggtgatagcatagattctgtaattgatagagagtatgaattaaaggtt
attgcgagattatcattttatgatttaggacccaaactagaagggttttttgaaaatggc
agatttgaaaaatacattgagggttcgaggacatctactcaagccgactttatagatcgg
gatacttcaataaaaattgctaaaaaattgaaagagttgcattgtactgttccattaacg
cataaagaaataacggatcaaccgtcatgctggacaacctttgatcagtggatcaaatta
atagactcgcataaagagtgggtttccaataatgtaaatataagtgaaaatttacgctgt
tcaagttggaatttttttttaaagagtttcaaaaattataagcgttggttgtataatgat
tctgcttttacctcaaaattattaagagaggatgataaagatagtatgataaattctggg
ctaaaaatggtattttgccataacgacttacagcatggtaatttactttttaaaagtaag
ggtaaggatgacatctcagtgggcgatttaacaattattgactttgagtacgcaggccct
aaccccgttgtatttgatttatcaaatcatttgaatgaatggatgcaagactataatgat
gtgcagtctttcaagtctcatattgataagtatccaaaagaagaagatattttagttttt
gcacaaagttatataaatcacatgaatgagaaccatgtcaaaattgcttctcaagaggtt
aggattctttacaatctaatcatcgaatggaggccttgtacacaattattctggtgcctt
tgggctcttttgcaaagcggaaggctaccacaacgaccactgatagaaggtgaaaaacta
atgagcgaaaaggctggactaggtgatgaaacgcaccttatggagcacaaaaataaagag
aatggaaaatacgattgttctgaagatgattcgttcaactatttaggattttgtaaagaa
aaaatgtctgtcttttggggcgatttaattacattgggagttatcgacaaagactgccca
gatattggaaaaacagattacttagacactaaacttattttttaa

DBGET integrated database retrieval system