KEGG   Saccharomyces cerevisiae (budding yeast): YDR148CHelp
Entry
YDR148C           CDS       T00005                                 

Gene name
KGD2
Definition
(RefSeq) alpha-ketoglutarate dehydrogenase KGD2
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00020  Citrate cycle (TCA cycle)
sce00310  Lysine degradation
sce00380  Tryptophan metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YDR148C (KGD2)
  09105 Amino acid metabolism
   00310 Lysine degradation
    YDR148C (KGD2)
   00380 Tryptophan metabolism
    YDR148C (KGD2)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YDR148C (KGD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N
Motif
Other DBs
NCBI-GeneID: 851726
NCBI-ProteinID: NP_010432
SGD: S000002555
UniProt: P19262
Position
IV:complement(753675..755066)
Genome map
AA seq 463 aa AA seqDB search
MLSRATRTAAAKSLVKSKVARNVMAASFVKRHASTSLFKQANKVESLGSIYLSGKKISVA
ANPFSITSNRFKSTSIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVN
SPVSGTVTKLNFKPEDTVTVGEELAQVEPGEAPAEGSGESKPEPTEQAEPSQGVAARENS
SEETASKKEAAPKKEAAPKKEVTEPKKADQPKKTVSKAQEPPVASNSFTPFPRTETRVKM
NRMRLRIAERLKESQNTAASLTTFNEVDMSALMEMRKLYKDEIIKKTGTKFGFMGLFSKA
CTLAAKDIPAVNGAIEGDQIVYRDYTDISVAVATPKGLVTPVVRNAESLSVLDIENEIVR
LSHKARDGKLTLEDMTGGTFTISNGGVFGSLYGTPIINSPQTAVLGLHGVKERPVTVNGQ
IVSRPMMYLALTYDHRLLDGREAVTFLKTVKELIEDPRKMLLW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgctttccagagcgacgcgtactgcagctgccaaatccttagtaaaatctaaagtggct
agaaatgttatggctgcttctttcgtcaagagacatgcttctacaagtttgttcaaacaa
gctaacaaggtcgaatccttaggttcaatatatttatccggcaagaaaatttcagttgcg
gcgaatccgttctccataactagcaatcgttttaaatctacctctattgaagttcctccg
atggcagagtccctgactgaaggctctttaaaggaatatactaaaaacgttggtgatttt
attaaggaggacgagctgttggccactattgagaccgataaaattgatattgaggtcaat
tcgccagtatcaggtactgttacgaagctaaatttcaaaccagaggacactgtcactgtt
ggtgaggagttagctcaggtcgagcctggtgaagcacctgctgagggttctggagaatct
aagccagagcctaccgaacaagcggagccatcgcaaggtgtcgccgcaagggaaaactca
agtgaggaaacggcttcaaagaaagaagctgctccaaagaaagaagccgctccaaagaaa
gaagttacagaaccaaaaaaggctgatcaaccaaagaagaccgtctctaaggcgcaggaa
cccccagtagcctctaactctttcacaccatttccacgtacagaaaccagggtcaaaatg
aaccgtatgagattgaggattgccgaaagattaaaagagtctcaaaacactgctgcttcc
ttaaccacattcaacgaagttgacatgtcagctttgatggaaatgaggaaactgtataaa
gatgagattattaagaagaccggtactaaattcggattcatgggtcttttctccaaagca
tgtaccttggccgccaaggatattccagccgtcaatggtgccattgaaggtgaccagatt
gtttatcgtgattacacagatatttctgttgctgtggccactccaaagggtttggttacc
cccgtcgttcgtaatgcagagtcattgagtgttttagatattgagaacgaaattgttcgc
ttgagtcataaagcgcgtgatggcaaattaaccctagaagatatgacgggtggtactttc
accatatctaatggtggtgtttttggttcattatacggtactcctatcatcaattcacca
caaacagccgtcctaggcttgcatggtgtcaaagagagacctgtcactgttaatggacaa
attgtctcaagaccaatgatgtacttggctttgacttatgatcatagattgctagatggt
agagaagctgttaccttcttgaagactgttaaagagttgattgaagaccctagaaaaatg
ttgttatggtga

DBGET integrated database retrieval system