KEGG   Saccharomyces cerevisiae (budding yeast): YDR150WHelp
Entry
YDR150W           CDS       T00005                                 

Gene name
NUM1, PAC12
Definition
(RefSeq) Num1p
  KO
K17978  nuclear migration protein NUM1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YDR150W (NUM1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    YDR150W (NUM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mcp5_PH PH PH_2
Motif
Other DBs
NCBI-GeneID: 851727
NCBI-ProteinID: NP_010434
SGD: S000002557
UniProt: Q00402
Position
IV:755628..763874
Genome map
AA seq 2748 aa AA seqDB search
MSHNNRHKKNNDKDSSAGQYANSIDNSLSQESVSTNGVTRMANLKADECGSGDEGDKTKR
FSISSILSKRETKDVLPEFAGSSSHNGVLTANSSKDMNFTLELSENLLVECRKLQSSNEA
KNEQIKSLKQIKESLSDKIEELTNQKKSFMKELDSTKDLNWDLESKLTNLSMECRQLKEL
KKKTEKSWNDEKESLKLLKTDLEILTLTKNGMENDLSSQKLHYDKEISELKERILDLNNE
NDRLLISVSDLTSEINSLQSNRTERIKIQKQLDDAKASISSLKRKVQKKYYQKQHTSDTT
VTSDPDSEGTTSEEDIFDIVIEIDHMIETGPSVEDISEDLVKKYSEKNNMILLSNDSYKN
LLQKSESASKPKDDELMTKEVAENLNMIALPNDDNYSKKEFSLESHIKYLEASGYKVLPL
EEFENLNESLSNPSYNYLKEKLQALKKIPIDQSTFNLLKEPTIDFLLPLTSKIDCLIIPT
KDYNDLFESVKNPSIEQMKKCLEAKNDLQSNICKWLEERNGCKWLSNDLYFSMVNKIETP
SKQYLSDKAKEYDQVLIDTKALEGLKNPTIDFLREKASASDYLLLKKEDYVSPSLEYLVE
HAKATNHHLLSDSAYEDLVKCKENPDMEFLKEKSAKLGHTVVSNEAYSELEKKLEQPSLE
YLVEHAKATNHHLLSDSAYEDLVKCKENPDMEFLKEKSAKLGHTVVSNEAYSELQRKYSE
LEKEVEQPSLAYLVEHAKATDHHLLSDSAYEDLVKCKENPDVEFLKEKSAKLGHTVVSSE
EYSELQRKYSELEKEVEQPSLAYLVEHAKATDHHLLSDSAYEELVKCKENPDMEFLKEKS
AKLGHTVVSNEAYSELEKKLEQPSLAYLVEHAKATDHHLLSDSAYEDLVKCKENSDVEFL
KEKSAKLGHTVVSNEAYSELEKKLEQPSLAYLVEHAKATDHHLLSDSAYEDLVKCKENPD
MEFLKEKSAKLGHTVVSNEAYSELEKKLEQPSLEYLVEHAKATNHHLLSDSAYEDLVKCK
ENPDMEFLKEKSAKLGHTVVSNEAYSELEKKLEQPSLEYLVEHAKATNHHLLSDSAYEEL
VKCKENPDVEFLKEKSAKLGHTVVSNEAYSELEKKLEQPSLEYLVEHAKATNHHLLSDSA
YEELVKCKENPDVEFLKEKSAKLGHTVVSNEAYSELEKKLEQPSLAYLVEHAKATDHHLL
SDSAYEDLVKCKENPDVEFLKEKSAKLGHTVVSNEAYSELEKKLEQPSLAYLVEHAKATD
HHLLSDSAYEDLVKCKENPDMEFLKEKSAKLGHTVVSNEAYSELEKKLEQPSLEYLVEHA
KATNHHLLSDSAYEDLVKCKENPDMEFLKEKSAKLGHTVVSNKEYSELEKKLEQPSLEYL
VKHAEQIQSKIISISDFNTLANPSMEDMASKLQKLEYQIVSNDEYIALKNTMEKPDVELL
RSKLKGYHIIDTTTYNELVSNFNSPTLKFIEEKAKSKGYRLIEPNEYLDLNRIATTPSKE
EIDNFCKQIGCYALDSKEYERLKNSLENPSKKFIEENAALLDLVLVDKTEYQAMKDNASN
KKSLIPSTKALDFVTMPAPQLASAEKSSLQKRTLSDIENELKALGYVAIRKENLPNLEKP
IVDNASKNDVLNLCSKFSLVPLSTEEYDNMRKEHTKILNILGDPSIDFLKEKCEKYQMLI
ISKHDYEEKQEAIENPGYEFILEKASALGYELVSEVELDRMKQMIDSPDIDYMQEKAARN
EMVLLRNEEKEALQKKIEYPSLTFLIEKAAGMNKILVDQIEYDETIRKCNHPTRMELEES
CHHLNLVLLDQNEYSTLREPLENRNVEDLINTLSKLNYIAIPNTIYQDLIGKYENPNFDY
LKDSLNKMDYVAISRQDYELMVAKYEKPQLDYLKISSEKIDHIVVPLSEYNLMVTNYRNP
SLSYLKEKAVLNNHILIKEDDYKNILAVSEHPTVIHLSEKASLLNKVLVDKDDFATMSRS
IEKPTIDFLSTKALSMGKILVNESTHKRNEKLLSEPDSEFLTMKAKEQGLIIISEKEYSE
LRDQIDRPSLDVLKEKAAIFDSIIVENIEYQQLVNTTSPCPPITYEDLKVYAHQFGMELC
LQKPNKLSGAERAERIDEQSINTTSSNSTTTSSMFTDALDDNIEELNRVELQNNEDYTDI
ISKSSTVKDATIFIPAYENIKNSAEKLGYKLVPFEKSNINLKNIEAPLFSKDNDDTSVAS
SIDLDHLSRKAEKYGMTLISDQEFEEYHILKDNAVNLNGGMEEMNNPLSENQNLAAKTTN
TAQEGAFQNTVPHNDMDNEEVEYGPDDPTFTVRQLKKPAGDRNLILTSREKTLLSRDDNI
MSQNEAVYGDDISDSFVDESQEIKNDVDIIKTQAMKYGMLCIPESNFVGASYASAQDMSD
IVVLSASYYHNLMSPEDMKWNCVSNEELQAEVKKRGLQIALTTKEDKKGQATASKHEYVS
HKLNNKTSTVSTKSGAKKGLAEAAATTAYEDSESHPQIEEQSHRTNHHKHHKRQQSLNSN
STSKTTHSSRNTPASRRDIVASFMSRAGSASRTASLQTLASLNEPSIIPALTQTVIGEYL
FKYYPRLGPFGFESRHERFFWVHPYTLTLYWSASNPILENPANTKTKGVAILGVESVTDP
NPYPTGLYHKSIVVTTETRTIKFTCPTRQRHNIWYNSLRYLLQRNMQGISLEDIADDPTD
NMYSGKIFPLPGENTKSSSKRLSASRRSVSTRSLRHRVPQSRSFGNLR
NT seq 8247 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacaacaacaggcataaaaagaataacgataaagacagctcagcagggcagtat
gcaaatagcattgacaattcattaagccaggaaagcgtctcaacgaacggcgtaacaagg
atggctaacttaaaggctgatgaatgcggcagtggtgatgaaggagataaaacaaagcgg
ttttcgatttcaagtattttgagtaaaagagagacaaaagacgtgcttccggaatttgca
ggcagtagttcccacaatggagtactcacggcgaattcatcaaaggatatgaactttact
ttggaactaagcgagaatttgttggttgagtgtaggaaattgcaatcctctaatgaagct
aaaaatgagcaaatcaagtctctcaagcaaattaaagagtcattaagtgacaagattgag
gagctcactaaccaaaaaaagtccttcatgaaagagttggattcaactaaagatttaaac
tgggatttagaatctaaattaacaaacttgagcatggaatgtaggcaattaaaagaattg
aagaaaaagactgaaaaatcttggaatgatgaaaaagaaagcctgaaacttctgaaaaca
gatttggaaattttaacattaacaaaaaatggcatggaaaatgatcttagctctcaaaaa
cttcattacgataaagagattagtgaattaaaggaaaggattttagacttaaataatgaa
aacgacagattacttattagtgtttctgatctaacaagtgaaattaattccttacagagc
aatagaactgaaagaataaaaattcaaaagcaacttgatgacgccaaagcatctatttct
tcgttaaaaagaaaagtacaaaagaagtattatcaaaaacagcatacttccgatactaca
gtaacatctgatcctgattctgaggggaccactagtgaagaagacatttttgatatagtg
atcgaaattgaccacatgattgaaacaggcccctctgtcgaggacatttctgaagatctt
gtcaagaaatactcagaaaaaaacaatatgatattgttatcgaatgattcatataaaaac
ttactacaaaaaagtgaaagtgcatccaaaccaaaagacgatgaattaatgaccaaagag
gtggctgaaaacctgaatatgatcgcgttaccaaatgatgacaattacagcaaaaaagag
ttttcgttagaatctcatattaaatatttagaagcttctggctataaagttcttcctcta
gaggagtttgagaacctaaacgaatccctatcaaatccatcatataactatctcaaggaa
aaacttcaggctttgaaaaagatacccatcgatcaaagtacgtttaacttgttaaaagag
cctactattgattttttactgcctttaacatccaaaattgattgcctgataatacctacc
aaagattataatgacctttttgagagtgtcaagaatccatcaattgaacaaatgaaaaaa
tgcctggaagcaaagaacgacttacaatcgaatatttgtaaatggctggaggagagaaac
ggctgtaaatggctaagtaatgatctgtatttttcaatggttaataagatagaaacacct
tcgaaacaatacctgtcagataaggcaaaagaatacgaccaagtgctgattgatactaaa
gccttagaaggtttaaagaacccaacgatagactttctaagagaaaaagcttctgcatca
gattatttattactcaaaaaagaagactacgtgagcccatcactggaatacctagttgaa
catgccaaggccaccaatcaccatttactatcggatagtgcatacgaagacctagtcaag
tgcaaggagaatcctgatatggaattcttgaaggagaagtctgccaaactaggccacact
gtggtatccaacgaggcatattctgaattggaaaagaaactagaacaaccatcactggaa
tacctagttgaacatgccaaggcgaccaatcaccatttactatcggatagtgcatacgaa
gacctagtcaagtgcaaggagaatcctgatatggaattcttgaaggagaagtctgccaaa
ctaggccatactgtggtatccaacgaggcatattctgaattgcaacgcaaatactcagaa
ttggagaaggaagtagaacaaccatctctagcatacttagttgaacacgccaaggctacc
gatcaccatttactatcggatagtgcatacgaagacctagtcaagtgcaaggagaatcct
gatgtggaattcttgaaggagaagtctgctaaactaggccatactgtggtatctagcgag
gaatattctgaattgcaacgcaaatactcagaattggagaaggaagtagaacaaccatca
ctagcatacctagtcgaacacgccaaggctaccgatcaccatttactatcggatagtgca
tacgaagaactagtcaagtgcaaggagaatcctgatatggaattcttgaaggagaagtct
gccaaactaggccacactgtggtatccaacgaggcatattctgaattggaaaagaaacta
gaacaaccatcactagcatacctagtcgaacatgccaaggctaccgatcaccatctgcta
tcggatagtgcatacgaagacctagtcaagtgcaaggaaaattctgatgtagaattcttg
aaggagaagtctgctaaactaggccatactgtggtatccaacgaagcatattctgaattg
gaaaagaaactagaacaaccatcactagcatacctagtcgaacatgccaaggctaccgat
caccatctgctatcggatagtgcatacgaagacctagtcaagtgcaaggagaatcctgat
atggaattcttgaaggagaagtctgccaaactaggccacactgtggtatccaacgaggca
tattctgaattggaaaagaaactagaacaaccatcactggaatacctagttgaacatgcc
aaggccaccaatcaccatttactatcggatagtgcatacgaagacctagtcaagtgcaag
gagaatcctgatatggaattcttgaaggagaagtctgccaaactaggccacactgtggta
tccaacgaggcatattctgaattggaaaagaaactagaacaaccatcactggaataccta
gttgaacatgccaaggccaccaatcaccatctgctatcggatagtgcatacgaagaacta
gtcaagtgcaaggaaaatcctgatgtagaattcttgaaggagaagtctgctaaactaggc
catactgtggtatccaacgaagcatattctgaattggaaaagaaactagaacaaccatca
ctggaatacctagttgaacatgccaaggccaccaatcaccatctgctatcggatagtgca
tacgaagaactagtcaagtgcaaggaaaatcctgatgtagaattcttgaaggagaagtct
gctaaactaggccatactgtggtatccaacgaagcatattctgaattggaaaagaaacta
gaacaaccatcactagcatacctagtcgaacatgccaaggctaccgatcaccatctgcta
tcggatagtgcatacgaagacctagtcaagtgcaaggaaaatcctgatgtagaattcttg
aaggagaagtctgctaaactaggccatactgtggtatccaacgaagcatattctgaattg
gaaaagaaactagaacaaccatcactagcatacctagtcgaacatgccaaggctaccgat
caccatctgctatcggatagtgcatacgaagacctagtcaagtgcaaggagaatcctgat
atggaattcttgaaggagaagtctgccaaactaggccacactgtggtatccaacgaggca
tattctgaattggaaaagaaactagaacaaccatcactggaatacctagttgaacatgcc
aaggccaccaatcaccatctgctatcggatagtgcatacgaagacctagtcaagtgcaag
gagaatcctgatatggaattcttgaaggagaagtctgctaaactgggccatactgtggta
tccaacaaggaatattctgaattggaaaagaaactagaacaaccatcactggaatactta
gtcaaacatgccgaacaaatacaatcaaaaattatatcgatctcggacttcaacacctta
gctaatccatctatggaagatatggcttcaaaattgcaaaagttagaataccagattgtt
tcgaacgatgagtacattgcattgaaaaatacgatggaaaagccggacgttgagttacta
agatccaagttgaaaggttaccatataattgatacaacaacgtacaatgagctagtcagc
aatttcaattctcctacgttgaagtttattgaagagaaagccaaaagcaaaggttataga
ttaatagaacctaatgaataccttgacttgaataggatagccactacaccttctaaagaa
gagattgataacttctgcaaacaaattgggtgttacgctttggactctaaagaatatgaa
agactaaaaaattctctggagaatccctccaagaaatttatagaagaaaatgccgcatta
cttgatcttgtgctagtggacaaaacggagtaccaagcaatgaaagataatgcaagcaac
aagaaatcacttattccttcaaccaaggcacttgatttcgttacaatgcctgccccacag
cttgcttctgcagagaagtcatcactacaaaaaagaactttatctgatattgaaaatgag
ttaaaggccttaggctacgtcgcaattcgtaaagaaaacctgccaaacctagagaaacca
attgttgacaatgcctccaaaaatgatgtcttgaacctatgttcgaaattcagtttagta
ccattgtctactgaagaatatgataatatgagaaaggaacacactaaaatcttaaatatt
ctcggtgatccatctattgatttcctgaaggaaaaatgtgaaaaatatcaaatgctcata
attagtaaacatgattacgaagaaaagcaagaagccattgaaaatccaggctacgaattt
attttagaaaaagcatcagcactgggatatgaattagttagcgaggttgagctggatcgc
atgaaacaaatgattgattcaccagatattgactacatgcaagaaaaggctgcccgcaat
gaaatggtgttgttgaggaacgaggagaaggaagcattgcaaaagaaaatagaatatccc
tctttaacatttttaatcgaaaaggctgctggaatgaacaaaatacttgttgaccaaatc
gagtatgatgaaactataagaaaatgcaatcatcccactcggatggagctagaggaatcc
tgtcatcacttgaacttggttttgctcgaccaaaacgagtactcaactctaagagaacct
ttggaaaatcgaaatgttgaagacttaattaacaccttgagcaaactaaactacattgca
attcctaatactatctaccaagatttaattggaaagtatgagaatccaaactttgattat
ctaaaggattctttgaacaaaatggattacgtcgcaatctctagacaagattatgaattg
atggttgctaaatacgaaaagccacaactggattatttgaaaatttcttcagagaaaatc
gaccacattgtagtgcctctgtctgagtacaatttaatggttacaaattatagaaatccc
agcttgagctacttaaaagagaaagccgttttgaataatcatattttaataaaagaagat
gactataaaaacattttagcagtatcagaacatccgacagtgatccacctctccgaaaag
gcatctttattaaataaagtcttggtagacaaggatgattttgcgaccatgtcacgctcg
attgagaaaccaactatcgatttcttatccactaaggcgctatcaatggggaaaatacta
gttaatgaatctacgcataaaagaaacgagaaactattatctgaaccagattctgaattt
ttgacaatgaaagccaaggagcaagggctaattatcatttcagaaaaggaatattctgaa
ctgcgggatcaaatagatcgtcctagcctagatgttttgaaagaaaaggccgccattttt
gatagcatcatagtagaaaacatagaataccaacaactggtaaacactacaagtccctgc
cctcccattacttatgaagatttgaaagtatatgcccaccaattcggtatggaattatgc
ctccaaaaacccaacaaactttctggagctgagcgtgcagagcgcattgatgaacaatca
ataaatacgaccagcagtaactcgaccacaacatcgagcatgtttacagatgcactagat
gataatatcgaagagcttaatcgtgtcgaattgcagaataatgaagattatactgacata
atctcgaaatcatccacagtgaaagatgctaccattttcattcccgcctatgaaaacatc
aagaattctgctgaaaaattaggctacaaattagttccgttcgaaaaatcaaatatcaat
ctgaaaaacattgaagctccattattttcgaaggacaacgatgacactagcgttgccagt
agcatagatcttgatcacttatctagaaaagcagaaaaatatggtatgaccctcatttct
gatcaggaatttgaagaatatcatatactaaaagataacgcggttaatctgaatggtggc
atggaagaaatgaataatcccttgtcagaaaatcaaaacttagcagcaaaaaccacaaac
acagcgcaagaaggtgccttccaaaacaccgttccccacaatgatatggacaacgaagaa
gtcgaatatgggccggatgatccaacattcacagtaaggcaactcaagaaacccgctggc
gatcgtaatttgattttgactagtagggagaaaacactgttatcaagagatgataatata
atgagtcaaaatgaggcggtttatggtgacgatatatctgatagctttgtagatgaaagc
caagaaatcaaaaatgatgtagacattattaaaactcaagctatgaaatatggtatgttg
tgtattcctgaaagtaattttgtgggtgcatcatatgcaagtgctcaagatatgagcgat
atagttgtgctttccgcgtcctattaccataatctaatgtcacctgaagacatgaaatgg
aactgtgttagtaatgaagaattacaagcggaagttaaaaagcgtgggctccagattgca
ctaacaacaaaggaagataagaaaggtcaagccacggcatccaaacatgagtatgtgtcg
cataagctaaacaataaaacatctactgtgtccacaaagtctggagcaaaaaagggactt
gcagaagcagcagcaacaactgcttatgaagattccgaaagtcatccacaaatagaagag
cagtctcatcgtactaatcatcataagcaccataaacgtcaacagagtctgaattctaat
tcaacctcaaaaaccacacattcatcgaggaatacgccagcatctagacgagatatagta
gcatcatttatgtcacgtgcaggatctgccagtaggacggcatctttacaaactttagca
tcattgaacgaaccaagcataatacccgcgttaacccaaaccgtcattggggaatatttg
tttaagtattatccacgcttgggaccttttggattcgaatcacgtcatgaaagattcttc
tgggttcatccatataccttaactttgtactggtccgcttctaatcccatcctagagaat
cctgccaataccaaaacaaaaggtgttgccattctaggagtagaaagtgtcacagaccca
aacccatatccaacaggattgtatcacaaaagtattgttgttaccacagaaactaggact
attaagtttacttgtcctacaaggcaaagacacaatatttggtataattcattacgttat
ttacttcaaaggaacatgcaagggataagtttagaggacatcgctgatgatccaacagat
aatatgtattcaggaaagattttcccattgcccggcgaaaatacaaagagctccagtaaa
agacttagcgcatcgagaaggtccgtatctacaaggtctctaagacatagagtaccacaa
agccgatcatttggcaatttacgatag

DBGET integrated database retrieval system