KEGG   Saccharomyces cerevisiae (budding yeast): YDR152WHelp
Entry
YDR152W           CDS       T00005                                 

Gene name
GIR2
Definition
(RefSeq) Gir2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RWD DFRP_C DUF4207
Motif
Other DBs
NCBI-GeneID: 851730
NCBI-ProteinID: NP_010436
SGD: S000002559
UniProt: Q03768
Position
IV:765706..766503
Genome map
AA seq 265 aa AA seqDB search
MDYKEEQKQELEVLESIYPDELRIINDEYPKIKFEVAIKLELDTGDSTSVLTKEHTIIAE
FKLPENYPDEPCLISLEAQEVALNDNEEDNEEDEDEVEYDDHGNKVLKKFENLPDLISFK
GYLPELTVQLESQIETDMLLGMQMCFALISSIKERCEQWYSEQLNKLEKQYELEAQEREK
KEQAKFHGTKVTRESYLEWRSKFRQELKLDERDQVRRMKAHHGKLTGKQMFEQGVVGTGD
EYMEEDDASVDDVAKGLAKTEIANQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggattataaggaagaacagaagcaggaactagaagttttagagtccatttatcctgat
gaactgaggatcataaacgatgaatacccaaagattaaatttgaagtagccattaaatta
gagctggatacaggtgattctacttctgttttaaccaaagagcacactataatcgccgaa
ttcaagttaccagaaaactaccctgacgaaccatgcctgatttcattggaagctcaagaa
gtagccctcaatgacaacgaagaagataacgaggaagatgaagacgaggttgaatatgac
gaccatggtaataaagtactgaaaaagtttgaaaacctgccagatttaataagctttaag
gggtacttgcctgaattaaccgtacaattagaatcgcaaatcgaaaccgatatgttattg
ggtatgcaaatgtgttttgcattgatttcatccataaaagaaagatgtgagcaatggtat
agtgaacaattgaataagctcgagaagcagtacgagctggaagcacaagaacgtgaaaag
aaggaacaggccaagttccatggtactaaagtcacaagagaatcgtacttggaatggagg
tctaaatttcgccaagaactgaaactggatgaaagagaccaggtgagaaggatgaaggct
catcatgggaagctaaccggtaagcaaatgtttgaacaaggcgtggtgggcacaggcgac
gagtatatggaagaggatgacgcgagtgtagatgacgtagccaagggacttgccaagacc
gaaatagcaaatcaataa

DBGET integrated database retrieval system