KEGG   Saccharomyces cerevisiae (budding yeast): YDR153C
Entry
YDR153C           CDS       T00005                                 

Gene name
ENT5
Definition
(RefSeq) Ent5p
  KO
K12471  epsin
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YDR153C (ENT5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDR153C (ENT5)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    YDR153C (ENT5)
SSDB
Motif
Pfam: ENTH Cas_Csy4
Other DBs
NCBI-GeneID: 851731
NCBI-ProteinID: NP_010437
SGD: S000002560
UniProt: Q03769
Structure
PDB: 
5J08 5CMY 5CMW

Position
IV:complement(766736..767971)
AA seq 411 aa
MDSLSKKIQNLGIHDIRNAARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNR
YQVPLYLMTEYTLKRLVDHIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVD
TGDELNQIRSCLLTHKHILTREIAQFKVKFSNDGKMEIHERGIRKKGELILQYLEDSQFL
KKERAKNKKNALKIRQQGESSIYNANQISTSASYDNIDDDEFDADADGFDSEMDANNVTN
FNVPVETEANSNTRRRSHMEEQRRQRREILREQIKNKEQQRKRKQQQDSIPDLIDLDDST
STTNNITIDNGNNDNKNNNINSNSDDDDDEFGDFQSETSPDTTAPKTSNSKIDDLLDWDG
PKSDTDTTAAAQTSLPFAEKKQQKARPQATKDKSKGNDAFSDLFSYSKSLV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggactcattatcaaaaaagattcaaaatttaggtatccatgatattagaaatgccgca
aggtttgcccaaaacgtgatagtccaatatgagccttatcagatagatatccgtcgtgct
acaaataccgatgcttggggccccacaccgaagcacctcgccaaggttttaaggaacaga
taccaagtgccgctctacttgatgacagaatacacgttgaaaagattagtcgaccatatc
gctaccaggcccaagaacctatacgaaaaggcaagaaaggactacgttaattatgggtcc
gaatggagggtggtcttaaaatgtctagtagtcattgaattcctattattgaacgtcgac
acaggtgacgaactgaatcagattagatcatgtttgctcactcataagcatattttaacc
agggagattgcccaattcaaggtaaaattctccaatgatggtaaaatggagattcatgag
agaggtattaggaaaaagggagaacttatcttgcaatacttggaagactcacaatttttg
aaaaaggaaagagccaagaataagaagaatgccttgaaaattcgacagcaaggagaatcc
tccatttataatgccaaccagatttcaacgtctgcaagttacgataacatcgacgacgat
gaatttgatgcagatgcagatggctttgacagtgaaatggatgctaataatgtgaccaac
ttcaatgttcctgtggaaacagaagcaaattcgaatactcgcaggcgttctcatatggaa
gaacaaagaagacaaagaagggagatattaagagagcagatcaaaaataaagaacagcag
aggaaaagaaagcaacaacaagatagcatccctgacttaatcgatcttgacgatagtact
agcaccacgaataatataacaatagacaatggtaataatgacaacaaaaacaataatatc
aacagcaatagtgatgatgatgatgatgagtttggcgacttccaaagcgaaacgagtccc
gacacaacagcacctaaaacttccaatagtaaaatagatgatttgcttgactgggatggc
ccaaagtcagacacagataccaccgctgctgcgcaaacatcattgccctttgcggagaaa
aaacagcaaaaagcccgtcctcaggctacaaaggacaagtcgaagggaaatgatgcattt
tccgacttattctcttactccaagtcgttggtctaa

DBGET integrated database retrieval system