KEGG   Saccharomyces cerevisiae (budding yeast): YDR155CHelp
Entry
YDR155C           CDS       T00005                                 

Gene name
CPR1, CPH1, CYP1
Definition
(RefSeq) peptidylprolyl isomerase CPR1
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YDR155C (CPR1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     YDR155C (CPR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 851733
NCBI-ProteinID: NP_010439
SGD: S000002562
UniProt: P14832
Structure
PDB: 

Position
IV:complement(768512..769000)
Genome map
AA seq 162 aa AA seqDB search
MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFML
QGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWL
DGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaagtctattttgatgtcgaagctgatggccaaccaattggccgtgtcgttttc
aagttgtacaacgacatagtcccaaagactgcagaaaacttcagagctctatgtaccggt
gaaaagggattcggctacgctggctctccattccacagagttattccagacttcatgttg
caaggtggtgacttcactgctggtaacggtaccggcggtaagtctatctacggtggcaaa
ttcccagatgaaaacttcaagaagcaccacgacagaccaggtttgttgtccatggccaac
gccggtccaaacaccaacggttctcaattcttcatcaccaccgttccatgcccatggttg
gacggtaagcatgttgtctttggtgaagttgttgacggttacgacatcgttaagaaggtt
gagtccttgggttctccttccggtgccaccaaggctagaattgttgttgccaagtccggt
gaattataa

DBGET integrated database retrieval system