KEGG   Saccharomyces cerevisiae (budding yeast): YDR159WHelp
Entry
YDR159W           CDS       T00005                                 

Gene name
SAC3, LEP1
Definition
(RefSeq) Sac3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAC3_GANP SAC3
Motif
Other DBs
NCBI-GeneID: 851737
NCBI-ProteinID: NP_010443
SGD: S000002566
UniProt: P46674
Structure
PDB: 

Position
IV:771877..775782
Genome map
AA seq 1301 aa AA seqDB search
MNTSFGSVVPSTNFNFFKGHGNNDNTSANSTVNNSNFFLNSNETKPSKNVFMVHSTSQKK
SQQPLQNLSHSPSYTENKPDKKKKYMINDAKTIQLVGPLISSPDNLGFQKRSHKARELPR
FLINQEPQLEKRAFVQDPWDKANQEKMISLEESIDDLNELYETLKKMRNTERSIMEEKGL
VDKADSAKDLYDAIVFQGTCLDMCPTFERSRRNVEYTVYSYEKNQPNDKKASRTKALKVF
ARPAAAAAPPLPSDVRPPHILVKTLDYIVDNLLTTLPESEGFLWDRMRSIRQDFTYQNYS
GPEAVDCNERIVRIHLLILHIMVKSNVEFSLQQELEQLHKSLITLSEIYDDVRSSGGTCP
NEAEFRAYALLSKIRDPQYDENIQRLPKHIFQDKLVQMALCFRRVISNSAYTERGFVKTE
NCLNFYARFFQLMQSPSLPLLMGFFLQMHLTDIRFYALRALSHTLNKKHKPIPFIYLENM
LLFNNRQEIIEFCNYYSIEIINGDAADLKTLQHYSHKLSETQPLKKTYLTCLERRLQKTT
YKGLINGGEDNLASSVYVKDPKKDRIPSIADQSFLMENFQNNYNEKLNQNSSVKPQINTS
PKRVATRPNHFPFSQESKQLPQISQSHTLSTNPLLTPQVHGDLSEQKQQQIKTVTDGGSP
FVFDQSAQNSTVEASKAHMISTTSNGAYDEKLSSEQEEMRKKEEQRIEEEKTQLKKKQEN
ADKQVITEQIANDLVKEVVNSSVISIVKREFSEANYRKDFIDTMTRELYDAFLHERLYLI
YMDSRAELKRNSTLKKKFFEKWQASYSQAKKNRILEEKKREEIKLVSHQLGVPGFKKSTC
LFRTPYKGNVNSSFMLSSSDKNLIFSPVNDEFNKFATHLTKISKLWRPLEMQSIYYDNLT
KKFPSNSLTPANLFIYAKDWTSLSNRWILSKFNLQTAQDSKKFSNNIISSRIICIDDEYE
PSDFSDLQLLIFNTGVTNPDIFDLEMKLKDDGEELIKLITGISLNTNICFSLLIIYWESA
ENTLSESTIKHLLKLNRISKNYSSVIERIDLMNLTEESPHKCLEDKLSEISHSYVYKLTE
RGKYDKTLRQKRSLAGIHSRSTQLQTTKDIDQKMKKMLEKEKNKYQQQIGERNTYAHLES
HIDASPRSKKRKLPILLSTSHSSQFKTPLASRLNTSGSSTSPPLPSHLAMKFRKNSRVTS
LHTVLPVSTPSHSNNIPAASFSGNNTTDIQSQQLIENQKSTSVYLNNVSERILGNQEICQ
TPINPVTPVLDGADQGKEDIPDSILELKILIDSVKKKVNND
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatcatttggctcagtagtgccttccactaatttcaattttttcaaagggcat
ggaaataatgataacactagtgccaatagtactgttaacaacagcaatttctttttaaat
agcaatgaaacgaaaccttcgaaaaatgtcttcatggtgcactctacctctcaaaagaag
tcgcagcaaccgttacaaaatctctcacactcaccttcctacacggaaaataaaccagat
aaaaagaaaaaatatatgataaacgatgccaagaccattcaacttgtaggtccactgatt
tcctctcctgataatttgggatttcagaagagatcgcacaaagcaagagaattaccaagg
tttttgattaatcaagaacctcaattggagaaaagagcttttgtacaagatccctgggac
aaggctaatcaagaaaaaatgatctcattggaagaatccatagatgatctcaatgaattg
tatgaaacactaaaaaaaatgagaaatactgagcgatcgataatggaagaaaaagggcta
gtggataaagctgactcagcaaaggatctttacgatgctatagtatttcaaggtacctgt
ttagatatgtgtcccacattcgagagatcaagaagaaacgttgaatatactgtgtattca
tatgaaaaaaatcaaccaaatgataaaaaagcttctcgaactaaagcattgaaggtcttc
gcgaggccagcagcagcagcagctcctcctttaccttctgatgttaggccaccccatatt
ttagtcaagacattggactatattgtagataacttattaacaacattgcctgaaagcgaa
ggattcttatgggataggatgagatccataaggcaggactttacatatcagaactattca
ggacctgaggcggtagattgtaatgagcgtattgttaggatacatcttctgatcttgcat
atcatggtgaaatcaaatgtggaattttcgcttcaacaagaactagaacaattgcataaa
tcccttatcacgttatcagaaatatacgatgacgttcgttccagcggcggaacatgccca
aatgaggctgaatttcgagcttatgctctcctgagtaaaataagagaccctcaatacgat
gagaatatccaaagattaccaaaacatattttccaagataaattagttcaaatggcttta
tgtttcagaagggttatatctaactcagcttatactgaacgcgggtttgttaaaactgag
aattgtttaaacttctacgcaaggtttttccagttaatgcaatcacccagcttgccatta
ttaatgggattttttttgcaaatgcatctgacggatattagattttatgcgctaagagct
ttatcacatactttaaacaaaaagcataaaccaataccatttatttatttggaaaatatg
ttactctttaataatcggcaagaaataattgaattttgtaattattactcaattgaaatc
ataaatggggatgcagccgatttgaaaacattgcaacattattctcacaaattgtcagaa
acacaacctttaaaaaaaacataccttacctgcttagaaaggagattacagaaaactact
tacaagggtttaattaatggcggtgaagataatttggcttcttcggtttatgtgaaggac
ccaaaaaaggatagaataccttctatcgcagaccaatcttttttaatggaaaattttcaa
aacaactataacgaaaagttgaaccaaaactcatccgttaaaccacagatcaatacctct
ccaaaaagagttgcaacgcggcccaaccactttcctttttcacaggaatctaagcaatta
cctcaaatatctcaatctcatactttatcaacaaatcctttattaacgccacaggttcat
ggagacctatcggaacagaaacaacaacaaattaaaaccgtcacagacggaggctcccca
tttgtttttgatcaatcagcacagaattctacggtggaagcttccaaggctcatatgata
tccacgaccagcaatggtgcatatgatgagaagttgagttcagagcaagaagaaatgagg
aaaaaagaagaacaacgaatagaagaagagaaaactcaattgaaaaagaagcaagaaaat
gcggacaaacaagtaatcactgaacaaattgcaaatgacttagtaaaagaagtggtaaac
agtagcgtgattagtattgttaagcgtgaattttcagaggctaattataggaaggacttc
attgacacaatgacccgtgaactttatgacgcatttcttcatgaaaggttgtatctgata
tatatggattctcgtgctgaattgaaaaggaattccactctaaaaaaaaagttctttgag
aaatggcaagcatcttattctcaagcaaagaagaaccgtatattagaagaaaaaaaaagg
gaagaaattaaactcgtaagccaccaattaggagtaccaggttttaaaaaatctacatgt
ttgtttagaaccccgtataagggtaacgtaaattcatcatttatgctatcatcttcagat
aagaatctaatattttcacctgtaaatgacgagtttaataagtttgcgactcatttaacc
aagatttcaaaactttggcggccgttagagatgcaatcaatctattatgataaccttacg
aaaaagttcccctccaattctcttactccggcaaatttattcatttatgcgaaagattgg
acatcactctcaaaccgttggatcttaagtaagttcaatctgcaaacagcacaggattca
aaaaagttcagcaataatattatctctagcagaataatttgtattgatgatgaatatgaa
ccatctgattttagtgatttgcaattattgatatttaatacaggtgttacgaatccagat
atattcgatttggagatgaaactgaaagatgatggtgaagaactgataaagctaatcact
ggtatttctctaaatacaaatatatgcttttcccttttgattatttattgggaatccgca
gaaaatactttatcggaaagtaccattaaacacttactaaaattaaaccgaatatctaaa
aactatagtagtgttattgaacgcattgacttaatgaatctcaccgaagaatcccctcat
aagtgtttagaggacaaattatctgaaatatcacattcttatgtgtacaagttgacagaa
aggggaaaatatgataaaacacttcgtcagaaaaggtcattggccggcattcactcacgt
agcactcaactacaaactacaaaggacattgatcaaaagatgaagaaaatgctggaaaaa
gagaaaaacaagtaccaacaacaaataggcgaaaggaacacctatgcgcatctagaatcg
catatagatgcatcaccaagaagcaagaaaaggaaattgccaatactcctgtcaacttct
cattcgagccaatttaaaactcctctagcttctagattaaacacctctggttcgtctact
tcaccacctttaccatctcatttggcgatgaaattcaggaaaaactcgagagttactagt
ttacataccgtattacccgttagcacaccaagccatagtaataacataccagctgcaagt
tttagcgggaataacaccaccgatatacagtcccaacaattaatcgaaaaccagaagagt
acatctgtatatttgaataacgtttctgaaaggattctgggaaatcaagaaatatgtcaa
acaccaattaatcctgttactcctgtgctagatggggccgatcaaggtaaggaggacatt
cctgatagtatattagagctgaagatcttgatcgattctgtcaagaagaaagtaaataat
gattaa

DBGET integrated database retrieval system