KEGG   Saccharomyces cerevisiae (budding yeast): YDR160W
Entry
YDR160W           CDS       T00005                                 

Symbol
SSY1, RAA1, SHR10
Name
(RefSeq) Ssy1p
  KO
K16261  yeast amino acid transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDR160W (SSY1)
Transporters [BR:sce02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   YDR160W (SSY1)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 851738
NCBI-ProteinID: NP_010444
SGD: S000002567
UniProt: Q03770
Position
IV:776163..778721
AA seq 852 aa
MSSVNQIYDLFPNKHNIQFTDSHSQEHDTSSSLAKNDTDGTISIPGSIDTGILKSIIEEQ
GWNDAELYRSSIQNQRFFLTDKYTKKKHLTMEDMLSPEEEQIYQEPIQDFQTYNKRVQRE
YELRERMEEFFRQNTKNDLHILNEDSLNQQYSPLGPADYVLPLDRYSRMKHIASNFFRKK
LGIPRKLKRRSHYNPNAEGHTKGNSSILSSTTDVIDNASYRNIAIDENVDITHKEHAIDE
INEQGASGSESVVEGGSLLHDIEKVFNRSRATRKYHIQRKLKVRHIQMLSIGACFSVGLF
LTSGKAFSIAGPFGTLLGFGLTGSIILATMLSFTELSTLIPVSSGFSGLASRFVEDAFGF
ALGWTYWISCMLALPAQVSSSTFYLSYYNNVNISKGVTAGFITLFSAFSIVVNLLDVSIM
GEIVYVAGISKVIIAILMVFTMIILNAGHGNDIHEGVGFRYWDSSKSVRNLTYGLYRPTF
DLADAGEGSKKGISGPKGRFLATASVMLISTFAFSGVEMTFLASGEAINPRKTIPSATKR
TFSIVLISYVFLIFSVGINIYSGDPRLLSYFPGISEKRYEAIIKGTGMDWRLRTNCRGGI
DYRQISVGTGYSSPWVVALQNFGLCTFASAFNAILIFFTATAGISSLFSCSRTLYAMSVQ
RKAPPVFEICSKRGVPYVSVIFSSLFSVIAYIAVDQTAIENFDVLANVSSASTSIIWMGL
NLSFLRFYYALKQRKDIISRNDSSYPYKSPFQPYLAIYGLVGCSLFVIFMGYPNFIHHFW
STKAFFSAYGGLMFFFISYTAYKVLGTSKIQRLDQLDMDSGRREMDRTDWTEHSQYLGTY
RERAKKLVTWLI
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgagttctgtcaaccaaatatatgacctatttcccaataagcataatatccaatttaca
gattctcattcacaggagcatgatacttcgtccagccttgctaagaatgatacagacgga
actataagtataccaggtagtatagacactggcattttaaagagcattattgaggagcaa
ggttggaatgacgctgagttatatagaagttcaatacaaaatcaaagattttttttaacg
gataaatacactaaaaagaagcatttgactatggaggacatgcttagcccagaagaagaa
caaatatatcaggaacctattcaagatttccaaacatataacaaacgtgttcaaagggaa
tatgagctcagggaaaggatggaagaattcttccgtcaaaacaccaaaaatgatttacat
attttaaacgaggattcattaaatcagcaatattccccgttaggacctgcagattatgtt
ctgcccctcgatagatactccagaatgaaacacattgcctcaaactttttcagaaaaaaa
cttggtattcctagaaaactgaaaagaagaagccattataatcccaacgcagagggccac
accaaagggaattcttctatattgagttccactactgatgtaattgataacgccagctac
aggaatattgcaatagatgaaaatgttgacataacacataaagaacacgccattgacgaa
ataaacgagcagggtgcatcaggtagtgaatctgttgtggaaggtggatcgttattgcat
gacattgaaaaggttttcaataggtccagggcaactaggaaataccatatccaacggaaa
ttaaaagtgcgccatattcaaatgctttctatcggggcttgctttagtgtcggattattt
ttaacctcagggaaagccttttctattgccgggccatttggtacactacttgggtttgga
ctcacaggtagcatcattttagccacaatgctgtcatttacagagttatccacccttatt
cctgtgtcttctgggttctcaggactggcttctagatttgtagaggatgctttcggattt
gcattgggctggacgtattggatttcctgtatgcttgctcttcctgcccaagtttcctca
agtacattctatctcagctattataataatgtcaatatatcaaagggagtaacagcaggg
tttatcacgctgttttctgcatttagcattgtagtaaatttactggatgtcagcataatg
ggtgaaattgtatatgttgctggaataagcaaagtgataattgcaattttgatggttttc
acgatgatcatcctaaatgccggacatggaaatgacattcacgaaggagtcggttttaga
tattgggatagctctaaatctgtccgaaatttgacctacgggctatatcgtccaacattt
gacctggctgatgctggcgaaggaagcaaaaaaggaatttcaggcccaaaaggccgattt
ttagctacggcatcagtaatgctaatttcaacatttgcgtttagcggtgttgagatgact
tttttagctagtggggaagctataaatccaaggaaaacaattccttctgctacaaaaagg
acattttccattgtactgatatcttacgtttttttgattttttcggtaggcatcaacata
tacagtggcgatccaagactactatcatattttcctggtatttccgaaaagaggtatgaa
gccattataaaaggcacaggaatggactggagacttaggactaattgtcgcggcggtatt
gattataggcagatttcagtaggaacaggttattctagtccttgggttgttgcattgcag
aactttgggctatgtactttcgcatctgcttttaacgcaatactgatatttttcactgct
acagcagggatatcctcgttatttagttgttcaagaacactatacgccatgtctgtacaa
cggaaggcaccgccagttttcgaaatttgcagcaagagaggtgttccttatgtttcagtg
atattctcctctttattttcagtcattgcttatattgcagttgaccaaaccgcgattgaa
aacttcgacgtcttggccaatgtttctagtgctagtacgtctattatatggatgggattg
aatctttcctttttgcgattctattacgccctaaaacaaaggaaggatattatatcaaga
aatgattcatcatacccatataaatcgccattccaaccatatctagcgatttatggtcta
gttggatgttcattatttgttatatttatgggatatcctaactttatacatcatttctgg
agtactaaagcttttttttcagcatatggtggcctgatgtttttctttatcagttacaca
gcttataaggttctcggaacgtcaaagattcaaagactagatcagttagatatggacagt
gggaggagggaaatggacagaactgactggaccgaacatagccaatatttgggaacatat
agggaaagagcgaagaagttggttacctggctgatttag

DBGET integrated database retrieval system