KEGG   Saccharomyces cerevisiae (budding yeast): YDR201WHelp
Entry
YDR201W           CDS       T00005                                 

Gene name
SPC19
Definition
(RefSeq) Spc19p
  KO
K11572  DASH complex subunit SPC19
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR201W (SPC19)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    DASH complex
     YDR201W (SPC19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DASH_Spc19
Motif
Other DBs
NCBI-GeneID: 851782
NCBI-ProteinID: NP_010487
SGD: S000002609
UniProt: Q03954
Position
IV:856317..856814
Genome map
AA seq 165 aa AA seqDB search
MTDALEQSVLALEGTVSVLKDSVESLKCANEPSTNLASTMLQTKRVFRLVPEYDVERSKL
DLIEEVEPLVRTLGDKLRKSMGRMQRELDTLQQTYELNDLRLKKNISMDDDDALNSPDMG
QEYEGRDADDVVMMASSTNEELEELKKLKEKKKQLENKLEILKQK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgctttggaacagagcgtccttgcgttggagggaacagtttcagtattgaag
gattctgtggagtctttaaaatgtgcaaatgagccaagcacgaaccttgcatcgacaatg
ttgcaaaccaaaagggttttccgtttagttcccgaatatgatgttgaaagatcaaaatta
gatttgattgaagaggtagaaccgctggttaggactctgggcgataagttacgtaaatct
atgggtagaatgcaaagggaactcgatactttgcagcaaacttatgaattaaacgattta
aggctaaagaagaacattagtatggatgacgatgatgctctgaatagtccagacatgggt
caagaatacgaaggcagagacgcggacgacgtggttatgatggcatcttctactaatgag
gaattggaagaattgaagaaactaaaggaaaagaagaagcaactggagaataagttggaa
atactcaaacagaaatag

DBGET integrated database retrieval system