KEGG   Saccharomyces cerevisiae (budding yeast): YDR204WHelp
Entry
YDR204W           CDS       T00005                                 

Gene name
COQ4
Definition
(RefSeq) ubiquinone biosynthesis protein COQ4
  KO
K18586  ubiquinone biosynthesis protein COQ4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    YDR204W (COQ4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coq4
Motif
Other DBs
NCBI-GeneID: 851785
NCBI-ProteinID: NP_010490
SGD: S000002612
UniProt: O13525
Position
IV:858137..859144
Genome map
AA seq 335 aa AA seqDB search
MLRLSLLRSTATLPVKCQRRGLILPAAAMYTLGSLIFGKEARLADAMERGELHNKNVDYA
KEAEERTELRIRALANTRPMEPRYNGHVPLHRYEKLLLFAISGWNSFFHPEDGYNIVQLG
EATALPVFLENLKQTMLSDSSGRRILKEQPNITTEILHMDKLAKLPHNTFGYVYYQWLKR
ENVSPDTRAPVKFIDDPMHAYIFKRYRQCHDFYHAITNMPIIIEGEITIKALEGANLGVP
MAILGGILAPLRLKKVQRKRLYNIYLPWAVRTGLSCKPLINVYWEEMLEKDVTALRKELK
ITLPPDLRTMRKERAALRKEIDAKYNSQKRATTPA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggttatctttactgagatcaacagctactttgccagtgaaatgccaacgtcgt
gggctaatattacctgcggcggcaatgtacaccttaggctcattaatatttggtaaggaa
gcaaggttggcggatgccatggaacgtggtgagttacataacaagaacgttgattatgcg
aaagaagctgaagagcgtaccgagttacgtattagggccctggctaatactcggccaatg
gaacctcggtacaacggccatgttccccttcatcggtacgagaaattgctgctgtttgca
atttccggttggaattcatttttccatcctgaagatggttataatattgtacaattgggt
gaggcaactgcattgccggtcttcttggagaatttgaagcaaacaatgttaagtgattcc
tctgggaggcgcattttgaaggaacaacccaatatcacaacagagattttgcatatggac
aaactagctaaattgccacataacacgtttgggtatgtatattaccaatggttgaaaaga
gaaaacgtttctccggacactagagcacctgtcaaatttatcgacgatcctatgcatgca
tatatctttaagaggtatagacaatgccacgatttctatcacgctataaccaacatgcct
attatcattgagggggagatcaccataaaggctcttgaaggtgccaacctgggcgtccca
atggccattctcggtggtatccttgcacctttacgtttgaaaaaggtgcaaagaaaaaga
ttatataatatatatctcccttgggctgtcagaacaggtttaagctgcaagccattgatc
aacgtgtattgggaggaaatgctggagaaggatgttactgctttgaggaaagagctaaag
ataacactccctccggatctaaggacaatgaggaaggagcgtgcagcccttaggaaggag
attgacgcaaaatacaactcacagaaacgagccacgactccagcatga

DBGET integrated database retrieval system