KEGG   Saccharomyces cerevisiae (budding yeast): YDR206WHelp
Entry
YDR206W           CDS       T00005                                 

Gene name
EBS1
Definition
(RefSeq) Ebs1p
  KO
K11132  telomere elongation protein [EC:2.7.7.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YDR206W (EBS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     YDR206W (EBS1)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    YDR206W (EBS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EST1_DNA_bind EST1 WaaY
Motif
Other DBs
NCBI-GeneID: 851787
NCBI-ProteinID: NP_010492
SGD: S000002614
UniProt: Q03466
Position
IV:862054..864708
Genome map
AA seq 884 aa AA seqDB search
MEPSNTQKEDLPTAFNGIKSQLNSILKSNQLFQDYALLNGFLAFVHSKLNAAILTSIESQ
CGKSFAADLDSFDQSSISSILDFSWESVHYPIFKWFQMWRNYILFEKENKKQQTKFIDFR
KMNSKMLKFFKTVQNFYVNVINTVYKKYDISVLLPKRIIQDLKLSDIENTTNVGDILAVK
TFNSSSPLAHLIPTLFHRCLLFLGTAYRYKTLLEEISNKYSISNFKKSLDFFRLASLVLP
SAGETYSQAGAIFLQTGNLGIAVFNFVKGMMTKMPSPVSIKNFGALMVDNKSSLNRSLHT
TIMNTYLQESKGPRTPAKEILEFYFLGLFGSVWSPTSWRDDTKPNQLNNGIKLRHLENAL
YETMSARYLNNIKTIFHNLIITIGGFHLLLKRRSDVSAKTLKDLRSNELDYLNFAFKYIA
HILNDIVKESWSENPEVSEILGMVRIINCWIKANPMVLQYSQSNLEFVNALAYLINDIVK
KKPSPSFSITEHIPKRTYWFEEDLMVKGLSFVNFQLSDFDDYEKILEMDHSLDRLIGNPP
LCDKLSASSEMLLRLQAVVNISSQLLQNNNCGVEWSDNKSRYIFNKKIGFKETVKNSMKT
SKQSNEKAKLQRKNKPSTTNGSISMADLERQMRSSSLDSFSPTMGYSGSSVPMAPDTFNV
KPSGTITGNKVNVELLKIELSGQNADGAITNISPGYSNAAISSSNSTDESSFDLNNILSS
MQQKHAEKSFAKSMQGVNEQIPANDVCHQAQRPMQGGLYSSQQPSSMSSLNSAYQNASMP
PSASMVSYPYPFLNQQGQGVFPPYNAQNLQWQSEAYSLKSMNFANPTWLGDQYQTSAPSS
AYAQAQRQMFQQPMQQDVGKYMQFPFDAQSNTDSMRGNSRNNMF
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatcgaatacccaaaaagaagatcttcctaccgcttttaatggtataaaaagt
caattaaacagcatattaaaatcgaatcaattatttcaagattatgcgctattaaatggg
ttcttggcatttgttcattccaaattgaatgccgcaatccttacatctatagaatcacaa
tgtgggaaatcctttgcggctgatcttgattcttttgatcagagcagtatctcttcgatt
ttagatttttcttgggaaagcgttcactatccaatattcaaatggtttcagatgtggagg
aattatattctttttgagaaggagaataaaaaacagcagaccaaatttatcgactttaga
aagatgaattcgaagatgttaaaattcttcaaaacggtgcaaaacttctatgtcaacgtt
atcaacacggtttataagaaatatgatatatctgtacttttgccgaaaaggattatccaa
gacttaaagttaagtgacatcgaaaataccactaatgttggagacattcttgcggtgaag
acatttaatagtagtagcccactcgcacatctcatcccaacgcttttccatcgctgtctc
ttattcttaggaacagcgtatcgttataaaactctcctcgaagaaatttccaataaatac
agcatatccaattttaaaaaatctctggacttctttcgtttagcttcgttggtgttacca
agtgctggtgagacgtattcgcaagcaggagcgatattccttcaaacaggaaatttgggg
attgcagtattcaattttgttaaaggtatgatgacgaagatgccaagccctgtttcaatc
aaaaattttggggcattaatggtggacaataaaagttcattaaatcgtagcttgcatact
actatcatgaacacttacttacaagaatctaaaggacccaggacacctgctaaagagata
ctagaattttatttcctgggcctttttgggtctgtttggtcacctaccagttggagagat
gatacaaaacctaaccaattaaataacggtatcaagttaaggcatttggaaaatgcactc
tacgagacgatgtcagcaagatacctgaataatattaagaccatctttcacaatttgatc
attacaattggtgggttccatctattattaaaaaggcgttccgatgtaagtgcaaaaacc
ttgaaggatttacgtagcaatgaattggattacctaaattttgcattcaagtatattgct
cacattttaaatgatatcgttaaggaatcatggagcgaaaatcctgaggtttcagaaatt
ctaggtatggtaagaattatcaattgttggataaaagcaaatcccatggttcttcaatat
tcacaaagtaatctagagtttgttaatgccttggcatacttgataaatgatattgtgaaa
aaaaaaccaagtccttcttttagtataacagaacatattcctaaaaggacatactggttc
gaagaagacttaatggtgaagggtttatcattcgttaactttcaactatctgattttgac
gattatgaaaaaattcttgaaatggatcatagtctcgatagattaattggtaatccgcca
ttatgcgacaagttatcggcatcatctgaaatgctgttaaggttgcaggctgttgtgaat
ataagttcgcaattattgcagaacaacaactgcggagtagaatggtcagataataaatca
cgttatatctttaataagaaaattggatttaaggagaccgttaaaaatagtatgaagaca
tcgaagcaatccaatgaaaaggccaagttacaaagaaaaaacaaaccttcgaccactaat
ggctcaatatccatggcggatttggagagacaaatgagaagtagctctttggattctttt
tctccaactatgggttatagtggttcgtctgtacctatggccccagatacgttcaatgtt
aagcccagcggtacaataacggggaacaaagtaaatgtagaactgttaaaaatcgaacta
agcggtcaaaacgccgatggcgctattacgaatatatctcctggttacagtaacgcagcg
atctcttcttcaaattcgacagatgaatcatccttcgatttgaacaacatcctatcttca
atgcaacaaaagcacgcggaaaaatcatttgccaaatccatgcaaggggtgaatgaacaa
attccagcgaatgacgtctgccatcaagcccagaggccaatgcaaggtggtctgtattca
tcacagcaaccttcatcgatgtcttcattaaactccgcgtatcagaatgcctcgatgcct
ccatctgcctccatggtatcctatccctatccttttttgaaccagcaggggcaaggggtc
tttccgccttataatgcacaaaatttacaatggcagagcgaagcttactcattaaagtca
atgaattttgcaaatccaacgtggctaggtgaccagtaccagacatctgcgccgtcgtca
gcatatgcgcaagcgcaacggcaaatgtttcaacaacctatgcagcaagatgtggggaag
tacatgcaatttccttttgacgcccaaagcaacacggacagcatgaggggaaacagtcgg
aataatatgttttaa

DBGET integrated database retrieval system