KEGG   Saccharomyces cerevisiae (budding yeast): YDR207CHelp
Entry
YDR207C           CDS       T00005                                 

Gene name
UME6, CAR80, NIM2, RIM16
Definition
(RefSeq) DNA-binding transcriptional regulator UME6
  KO
K09243  transcriptional regulatory protein UME6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04138  Autophagy - yeast
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YDR207C (UME6)
   04139 Mitophagy - yeast
    YDR207C (UME6)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR207C (UME6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YDR207C (UME6)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Zinc finger
   Cys6 metabolic regulators in fungi
    YDR207C (UME6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_clus
Motif
Other DBs
NCBI-GeneID: 851788
NCBI-ProteinID: NP_010493
SGD: S000002615
UniProt: P39001
Position
IV:complement(865012..867522)
Genome map
AA seq 836 aa AA seqDB search
MLDKARSQSKHMDESNAAASLLSMETTANNHHYLHNKTSRATLMNSSQDGKKHAEDEVSD
GANSRHPTISSASIESLKTTYDENPLLSIMKSTCAPNNTPVHTPSGSPSLKVQSGGDIKD
DPKENDTTTTTNTTLQDRRDSDNAVHAAASPLAPSNTPSDPKSLCNGHVAQATDPQISGA
IQPQYTATNEDVFPYSSTSTNSNTATTTIVAGAKKKIHLPPPQAPAVSSPGTTAAGSGAG
TGSGIRSRTGSDLPLIITSANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNN
NEIGGYLRGGTKRGGSPSNDSQVQHNVHDDQCAVGVAPRNFYFNKDREITDPNVKLDENE
SKINISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQ
IPSQPPTSASSFTSTNNNNPQRNNINRGEDPFATSSRPSTGFFYGDLPNRNNRNSPFHTN
EQYIPPPPPKYINSKLDGLRSRLLLGPNSASSSTKLDDDLGTAAAVLSNMRSSPYRTHDK
PISNVNDMNNTNALGVPASRPHSSSFPSKGVLRPILLRIHNSEQQPIFESNNSTAVFDED
QDQNQDLSPYHLNLNSKKVLDPTFESRTRQVTWNKNGKRIDRRLSAPEQQQQLEVPPLKK
SRRSVGNARVASQTNSDYNSLGESSTSSAPSSPSLKASSGLAYTADYPNATSPDFAKSKG
KNVKPKAKSKAKQSSKKRPNNTTSKSKANNSQESNNATSSTSQGTRSRTGCWICRLRKKK
CTEERPHCFNCERLKLDCHYDAFKPDFVSDPKKKQMKLEEIKKKTKEAKRRAMKKK
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgctagacaaggcgcgctctcaaagcaaacacatggacgaatctaatgcggctgcctct
ctgctttcgatggaaacaaccgccaacaatcatcactatttgcacaataaaacatctcgt
gccacgctgatgaatagcagccaagacggcaaaaaacatgcagaagatgaagttagtgat
ggagctaactcccgccatcctacaatttccagtgctagcatcgaatctctcaagacaacc
tacgatgaaaaccctttgctttctattatgaaatcgacatgtgcgcccaacaacactccc
gtgcatactccgtctggttcgccgagtttgaaagtccaaagtggcggagatatcaaagac
gatcctaaggaaaacgatactactactacgaccaatactacacttcaagatcgccgtgac
agcgataacgctgtgcatgctgccgccagcccactcgcgccttccaatacaccttcggat
cctaagtcattgtgcaatggccatgtcgcacaggctacagacccacaaatttccggtgct
attcagccgcagtatactgcaaccaacgaggatgttttcccttactcctccacctccact
aatagtaacactgccactactactatcgtcgccggcgccaaaaaaaaaatacatttgccg
ccaccacaagctccagcggtttcttcccccggtaccaccgcagcaggctcgggcgcgggc
acgggctcgggcatccgttcccgcacaggatcggatttgccgctcatcattaccagcgcc
aacaagaacaacggtaagactaccaattcgcctatgtcgatactgagcagaaacaacagt
accaacaacaacgacaataattcgatacaaagctcagattcgagagaatcctctaataac
aatgagattggcgggtatttgcgcggcggaactaagcgcggcggcagtccatctaacgac
tctcaggtccagcataatgtgcatgatgaccaatgtgccgtgggcgtggcgcccaggaac
ttctatttcaacaaggatagagagataacagacccaaatgtaaaactggacgagaacgaa
tcaaaaatcaacatatcgttctggctaaattcgaaatacagagatgaggcttattctttg
aatgaatcatcctccaacaatgctagttcaaacacggatacgcctacaaactctcgacat
gcgaacaccagctcttccattaccagcagaaacaatttccagcattttaggttcaaccaa
ataccttctcaacctccaacttccgcatcttcgtttacaagcacaaacaacaacaaccct
caacggaacaatatcaatcgcggtgaagacccgtttgccacttcgtcaagaccttctact
gggtttttttacggcgatttgccgaatcgtaacaatagaaatagtcccttccatacaaat
gaacaatacatcccaccacctccaccgaaatacatcaattctaaattggatggattgaga
tcaagattattgctcggtccgaattctgcatcttcatctaccaaactagacgacgacttg
ggtacagcagcagcagtgctatcaaacatgagatcatccccatatagaactcatgataaa
cccatttccaatgtcaatgacatgaataacacaaatgcgctcggtgtgccggctagtagg
cctcattcgtcatcttttccatcaaagggtgtcttaagaccaattctgttacgtatccat
aattccgaacaacaacccattttcgaaagcaacaattctacagctgtttttgatgaagac
caggaccaaaatcaagacttgtctccttaccatttaaatctaaactctaaaaaggtttta
gatcccacttttgagtcaaggacaaggcaagttacttggaataagaatggtaagcgaata
gacagacgcctttctgctccagaacaacaacagcaactggaagttccaccattgaaaaaa
tcgagaaggtcagttggaaacgcaagagtagcaagccaaaccaatagcgattataattct
cttggcgaatcctcaacttcgtcagctccatcgtctccatctttgaaggcttcttctggc
ttggcatataccgctgattatcctaacgctacttcgccggatttcgctaaatctaaagga
aaaaatgtcaagcctaaggcaaaatcaaaggcgaaacagtcatcaaagaaaagaccaaat
aatactacttcgaaatcaaaagcaaacaattctcaagaatcgaataatgctacttcctca
acgtctcaaggtacaaggtcccgtactggttgctggatttgtagattaaggaaaaagaag
tgtaccgaggaaagaccgcactgtttcaactgtgaaaggttgaaattggactgtcactat
gacgcgttcaaaccagattttgtatctgatccaaagaaaaaacagatgaaactggaggaa
atcaagaaaaaaacaaaagaggccaaaagaagagcaatgaaaaaaaaataa

DBGET integrated database retrieval system