KEGG   Saccharomyces cerevisiae (budding yeast): YDR208WHelp
Entry
YDR208W           CDS       T00005                                 

Gene name
MSS4
Definition
(RefSeq) 1-phosphatidylinositol-4-phosphate 5-kinase
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00562  Inositol phosphate metabolism
sce01100  Metabolic pathways
sce04011  MAPK signaling pathway - yeast
sce04070  Phosphatidylinositol signaling system
sce04139  Mitophagy - yeast
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    YDR208W (MSS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YDR208W (MSS4)
   04070 Phosphatidylinositol signaling system
    YDR208W (MSS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YDR208W (MSS4)
   04139 Mitophagy - yeast
    YDR208W (MSS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDR208W (MSS4)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     YDR208W (MSS4)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    YDR208W (MSS4)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    YDR208W (MSS4)
 Endosome - Golgi transport
  Others
   Others
    YDR208W (MSS4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 851789
NCBI-ProteinID: NP_010494
SGD: S000002616
UniProt: P38994
Position
IV:868224..870563
Genome map
AA seq 779 aa AA seqDB search
MSVLRSQPPSVVPLHLTTSTSRKTEQEPSLLHSAIIERHQDRSVPNSNSNPDSNHRIKKD
RNNHTSYHSSSNSESNMESPRLSDGESSTPTSIEELNPTINNSRLVKRNYSISIDPLHDN
SNNNTDDDHPNTITSPRPNSTSNKEMQKYSFPEGKESKKITTPSLNSNNCLDLDNSSLVH
TDSYIQDLNDDHILLNKRVSRRSSRISAVTATSTTIKQRRNTQDSNLPNIPFHASKHSQI
LPMDDSDVIKLANGDTSMKPNSATKISHSMTSLPLHPLPQPSQKSKQYHMISKSTTSLPP
ENDHYYQHSRGTNHNHAANAAAVNNNTTTTTAATGLKRSESATAEIKKMRQSLLHKREMK
RKRKTFLVDDDRVLIGNKVSEGHVNFIIAYNMLTGIRVAVSRCSGIMKPLTPADFRFTKK
LAFDYHGNELTPSSQYAFKFKDYCPEVFRELRALFGLDPADYLVSLTSKYILSELNSPGK
SGSFFYYSRDYKYIIKTIHHSEHIHLRKHIQEYYNHVRDNPNTLICQFYGLHRVKMPISF
QNKIKHRKIYFLVMNNLFPPHLDIHITYDLKGSTWGRFTNLDKERLAKDRSYRPVMKDLN
WLEEGQKIKFGPLKKKTFLTQLKKDVELLAKLNTMDYSLLIGIHDINKAKEDDLQLADTA
SIEEQPQTQGPIRTGTGTVVRHFFREFEGGIRASDQFNNDVDLIYYVGIIDFLTNYSVMK
KLETFWRSLRHDTKLVSAIPPRDYANRFYEFIEDSVDPLPQKKTQSSYRDDPNQKNYKD
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcttgcgatcacaacctccttcagttgtaccgctacatctgacaacatccacc
agtcgcaaaacagaacaggaaccatcgctattgcactctgcaataattgagcgacatcaa
gaccgttcggtgccgaattcgaattcgaatccggattcgaaccatcgaataaaaaaggat
cgcaataatcacactagctaccattcttcatcgaattcggagtcaaacatggaaagtcct
cgcttgtcagatggtgagtcttccactccgacctctattgaagagttaaacccaacaata
aataattcgaggctggtgaagagaaactactcaatatcaattgatcctttgcatgacaac
agcaataataatacggatgatgatcatccaaacaccataacttctccccgaccaaatagc
actagtaacaaggaaatgcagaaatatagttttcccgaaggtaaggagtcgaagaaaata
acaacaccctcgttaaactcgaataattgtttggatttggacaattccagtcttgttcac
acagattcgtatatacaagacttaaatgacgatcatattttactaaacaagcgcgtttcg
aggcgatcttccagaatatcggcagtaacagcaacttccacgacaattaagcaaagaaga
aatactcaggattcaaacctgcccaatattccctttcacgcttccaagcattctcaaatt
ctacctatggatgattcagatgtaataaaattggccaatggagataccagcatgaaacca
aattctgctactaaaattagtcactcaatgacttctttgcctcttcacccacttccacaa
ccttctcaaaagtcaaagcaatatcatatgatatccaaatcaaccacttctttgccgcca
gagaatgaccactactatcaacacagtcgtggcaccaaccataatcacgctgctaatgct
gctgctgttaataataatactactactactaccgctgctacgggtctgaaaagatcagag
tctgcaacggcagaaattaagaagatgagacaatctttgctgcataaaagagaaatgaaa
aggaaaagaaaaacatttttggtggatgacgatcgtgttttgatcggtaataaagtcagt
gaaggccatgtcaactttattatagcttataacatgctaactggtattcgtgtcgcagtg
tcacgttgttctggcataatgaaacctttaactccggcagactttagatttacgaagaag
cttgcctttgattatcacggaaatgaattgaccccttcttctcagtatgcatttaagttt
aaggactactgtcccgaagtctttagggaacttcgtgcattattcggcttagaccctgct
gattatttggtttcgttaacttccaagtacattttgagtgagttgaactcgccaggtaaa
agtggttcatttttttattattcgagagattacaaatatattatcaagaccatacatcat
tctgagcatattcatctgagaaagcacatacaagaatactataaccatgtaagagacaat
ccaaacactttgatttgtcaattttatggtttgcatagagtgaaaatgcctatatcgttt
caaaataaaattaagcatcggaaaatttacttcctagtcatgaataacttatttccacca
cacttagacattcacattacttatgatttaaaaggttccacatggggccgttttaccaat
ttggataaagaaaggttggcgaaagatagatcatataggcctgtgatgaaagatttaaat
tggcttgaagaaggtcagaaaattaaattcggtccattgaagaagaagacttttttgaca
cagctgaaaaaagatgtggaattgcttgctaaattgaatacaatggactattccttgtta
attggcattcatgacatcaataaagctaaagaagacgacttacaattggcggatacggca
tctattgaggagcaaccacagactcaaggacccataagaaccggtaccggaacggtagta
cgacatttttttagagagtttgaaggtggaattcgagcatctgatcaattcaacaatgat
gtggatttgatttattacgtggggataatcgatttcttgactaattactcagttatgaag
aaattagaaacgttttggagaagtctacgccatgataccaagttggtgagtgccatacct
ccaagagactacgccaataggttttacgaattcatagaagattctgtagatcctctgccc
cagaaaaaaactcaatcgtcgtatagagacgaccctaaccagaaaaattataaagactga

DBGET integrated database retrieval system