KEGG   Saccharomyces cerevisiae (budding yeast): YDR210C-DHelp
Entry
YDR210C-D         CDS       T00005                                 

Gene name
YDR210W-D
Definition
(RefSeq) gag-pol fusion protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYA RVT_2 rve gag_pre-integrs Retrotran_gag_2
Motif
Other DBs
NCBI-GeneID: 851794
NCBI-ProteinID: NP_620387
SGD: S000007410
UniProt: Q99231
Position
IV:complement(join(878659..882621,882623..883927))
Genome map
AA seq 1755 aa AA seqDB search
MESQQLSNYPHISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNRSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSINSPSTDNDSISKS
TTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTLIRSAHHIHSASS
NPDINVVDAQKRNIPINAIGDLQFHFQDNTKTSIKVLHTPNIAYDLLSLNELAAVDITAC
FTKNVLERSDGTVLAPIVKYGDFYWVSKKYLLPSNISVPTINNVHTSESTRKYPYPFIHR
MLAHANAQTIRYSLKNNTITYFNESDVDWSSAIDYQCPDCLIGKSTKHRHIKGSRLKYQN
SYEPFQYLHTDIFGPVHNLPNSAPSYFISFTDETTKFRWVYPLHDRREDSILDVFTTILA
FIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGVAERLNRTLLD
DCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLDISTLLPFGQPV
IVNDHNPNSKIHPRGIPGYALHPSRNSYGYIIYLPSLKKTVDTTNYVILQGKDSRLDQFN
YDALTFDEDLNRLTASYQSFIASNEIQQSNDLNIESDHDFQSDIELYPEQPRNVLSKAVS
PTDSTPPSTHTEDSKRVSKTNIRAPREVDPNISESNILPSKKRSSTPQISDIESTDSGGM
HRLDVPLLAPMSQSNTHESSYASKSKDFRHSDSYSENETNHTNVPISSTGGTNNKTVPQI
SDQETEKRIIHRSPSIDASPPENNSSHNIVPIKTPTTVSEQNTEESIIADLPLPDLPPES
PTEFPDPFKELPPINSHQTNSSLGGIGDSNAYTTINSKKRSLEDNETEIKVSRDTWNTKN
MRSLEPPRSKKRIHLIAAVKAVKSIKPIRTTLRYDEAITYNKDIKEKEKYIEAYHKEVNQ
LLKMNTWDTDKYYDRKEIDPKRVINSMFIFNKKRDGTHKARFVARGDIQHPDTYDTGMQS
NTVHHYALMTSLSLALDNNYYITQLDISSAYLYADIKEELYIRPPPHLGMNDKLIRLKKS
LYGLKQSGANWYETIKSYLIKQCGMEEVRGWSCVFKNSQVTICLFVDDMILFSKDLNANK
KIITTLKKQYDTKIINLGESDNEIQYDILGLEIKYQRGKYMKLGMEKSLTEKLPKLNVPL
NPKGKKLRAPGQPGHYIDQDELEIDEDEYKEKVHEMQKLIGLASYVGYKFRFDLLYYINT
LAQHILFPSRQVLDMTYELIQFMWDTRDKQLIWHKNKPTKPDNKLVAISDASYGNQPYYK
SQIGNIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEAIPLLNNLSHLVQELNKKPIIK
GLLTDSRSTISIIKSTNEEKFRNRFFGTKAMRLRDEVSGNNLYVYYIETKKNIADVMTKP
LPIKTFKLLTNKWIH
NT seq 5268 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccaacaattatctaattacccacatatatctcatggtagcgcctgtgcttcg
gttacttctaaggaagtccacacaaatcaagatccgttagacgtttcagcttccaaaatt
caagaatatgataaggcttccactaaggctaactctcaacagacaacaacacctgcttca
tcagctgttccagagaacccccatcatgcctctcctcaacctgcttcagtaccacctcca
cagaatgggccgtacccacagcagtgcatgatgacccaaaaccaagccaatccatctggt
tggtcattttacggacacccatctatgattccgtatacaccttatcaaatgtcgcctatg
tactttccacctgggccacaatcacagtttccgcagtatccatcatcagttggaacgcct
ctgagcactccatcacctgagtcaggtaatacatttactgattcatcctcagcggactct
gatatgacatccactaaaaaatatgtcagaccaccaccaatgttaacctcacctaatgac
tttccaaattgggttaaaacatacatcaaatttttacaaaactcgaatctcggtggtatt
attccgacagtaaacggaaaacccgtacgtcagatcactgatgatgaactcaccttcttg
tataacacttttcaaatatttgctccctctcaattcctacctacctgggtcaaagacatc
ctatccgttgattatacggatatcatgaaaattctttccaaaagtattgaaaaaatgcaa
tctgatacccaagaggcaaacgacattgtgaccctggcaaatttgcaatataatggcagt
acacctgcagatgcatttgaaacaaaagtcacaaacattatcgacagactgaacaataat
ggcattcatatcaataacaaggtcgcatgccaattaattatgagaggtctatctggcgaa
tataaatttttacgctacacacgtcatcgacatctaaatatgacagtcgctgaactgttc
ttagatatccatgctatttatgaagaacaacagggatcgagaaacagcaaacctaattac
aggagaaatcggagtgatgagaagaatgattctcgcagctatacgaatacaaccaaaccc
aaagttatagctcggaatcctcaaaaaacaaataattcgaaatcgaaaacagccagggct
cacaatgtatccacatctattaactctcccagcacggacaacgattccatcagtaaatca
actactgaaccgattcaattgaacaataagcacgaccttcatcttggccagaaacttact
gaatctacagtaaatcatactaatcattctgatgatgaactccctggacacctccttctc
gattcaggagcatcacgaacccttataagatctgctcatcacatacactcagcatcatct
aatcctgacataaacgtagttgatgctcaaaaaagaaatataccaattaacgctattggt
gacctacaatttcacttccaggacaacaccaaaacatcaataaaggtattgcacactcct
aacatagcctatgacttactcagtttgaatgaattggctgcagtagatatcacagcatgc
tttaccaaaaacgtcttagaacgatctgacggcactgtacttgcacctatcgtaaaatat
ggagacttttactgggtatctaaaaagtacttgcttccatcaaatatctccgtacccacc
atcaataatgtccatacaagtgaaagtacacgcaaatatccttatcctttcattcatcga
atgcttgcgcatgccaatgcacagacaattcgatactcacttaaaaataacaccatcacg
tattttaacgaatcagatgtcgactggtctagtgctattgactatcaatgtcctgattgt
ttaatcggcaaaagcaccaaacacagacatatcaaaggttcacgactaaaataccaaaat
tcatacgaaccctttcaatacctacatactgacatatttggtccagttcacaacctacca
aatagtgcaccatcctatttcatctcatttactgatgagacaacaaaattccgttgggtt
tatccattacacgaccgtcgcgaggactctatcctcgatgtttttactacgatactagct
tttattaaaaaccagtttcaggccagtgtcttggttatacaaatggaccgtggttctgag
tatactaacagaactctccataaattccttgaaaaaaatggtataactccatgctataca
accacagcggattcccgagcacatggagtcgctgaacggctaaaccgtaccttattagat
gactgccgtactcaactgcaatgtagtggtttaccgaaccatttatggttctctgcaatc
gaattttctactattgtgagaaattcactagcttcacctaaaagcaaaaaatctgcaaga
caacatgctggcttggcaggacttgatatcagtactttgttacctttcggtcaacctgtt
atcgtcaatgatcacaaccctaactccaaaatacatcctcgtggcatcccaggctacgct
ctacatccgtctcgaaactcttatggatatatcatctatcttccatccttaaagaagaca
gtagatacaactaactatgttattcttcagggcaaggactccagattagatcaattcaat
tacgacgcactcactttcgatgaagacttaaaccgtttaactgcttcatatcaatcgttc
attgcgtcaaatgagatccaacaatccaatgatcttaacatagaatcagaccatgacttt
caatctgatattgaactatatcctgagcaaccgagaaatgtcctttcaaaagctgtgagt
ccaaccgattccacacccccgtcaactcatactgaagattcgaaacgtgtttctaaaacc
aatattcgcgcacccagagaagttgaccccaacatatctgaatctaatattcttccatct
aagaagagatctagcaccccccaaatttccgatatcgagagtaccgattcgggtggtatg
catagattagatgttcctttacttgctcccatgtcccaatctaacacacatgagtcgtcg
tacgccagtaaatctaaagatttcagacactcagactcgtacagtgaaaatgagactaat
catacaaacgtaccaatatccagtacgggtggtaccaacaacaaaactgttccgcagata
agtgaccaagagactgagaaaaggattatacaccgttcaccttcaatcgatgcttctcca
ccggaaaataattcatcgcacaatattgttcctatcaaaacgccaactactgtttctgaa
cagaataccgaggaatctatcatcgctgatctcccactccctgatctacctccagaatct
cctaccgaattccctgacccatttaaagaactcccaccgataaattctcatcaaactaat
tccagtttgggtggtattggtgactctaatgcctatactactatcaacagtaagaaaaga
tcattagaagataatgaaactgaaattaaggtatcacgagacacatggaatactaagaat
atgcgtagtttagaacctccgagatcgaagaaacgaattcacctgattgcagctgtaaaa
gcagtaaaatcaatcaaaccaatacggacaactttaagatacgatgaggcaatcacctat
aataaagatattaaagaaaaggaaaaatatatcgaagcataccacaaagaagtcaaccaa
ctattgaaaatgaatacttgggacactgacaaatattatgacagaaaagaaatagaccct
aaaagagtaataaactcaatgtttatcttcaacaagaaacgtgacggaactcataaagct
agatttgttgcaagaggtgacattcagcatcctgatacgtacgatacaggtatgcaatcc
aacactgtacatcattatgcgttgatgacatccctgtcacttgcattagacaataactac
tatattacacaattagacatatcttcggcatatttgtatgcagacatcaaagaagaatta
tacataagacctccaccacatttaggaatgaatgataagttgatacgtttgaagaaatca
ctttatggattgaaacaaagtggagcgaactggtacgaaactatcaaatcatacctgata
aaacagtgtggtatggaagaagttcgtggatggtcatgcgtatttaagaatagtcaagta
acaatttgcttattcgttgatgatatgatattgttcagcaaagacttaaatgcaaataag
aaaatcataacaacactcaagaaacaatacgatacaaagataataaatctgggtgaaagt
gataacgaaattcagtacgacatacttggcttagaaatcaaatatcaaagaggtaaatac
atgaaattaggtatggaaaaatccttgacagaaaaattacccaaactaaacgtacctttg
aacccaaaaggaaagaaacttagagctccaggtcaaccaggtcattatatagaccaggat
gaactagaaatagatgaagatgaatacaaagagaaagtgcatgaaatgcaaaagttgatt
ggtctagcttcatatgttggatataaatttagatttgacttactatactacatcaacaca
cttgctcaacatatactattcccctctaggcaagttttagacatgacatatgagttaata
caattcatgtgggacactagagataaacaattaatatggcacaaaaacaaacctaccaag
ccagataataaactagtcgcaataagtgatgcttcatatggtaaccaaccatattacaag
tcacaaattggtaacattttcctactcaacggaaaagtgattggaggaaagtcgacaaag
gcttcgttaacatgcacttcaactacagaagcagaaatacacgcagtcagtgaagctatt
ccgctattgaataacctcagtcaccttgtgcaagaacttaacaagaaaccaattattaaa
ggcttacttactgatagtagatcaacgatcagtataattaagtctacaaatgaagagaaa
tttagaaacagattttttggcacaaaggcaatgagacttagagatgaagtatcaggtaat
aatttatacgtatactacatcgagaccaagaagaacattgctgatgtgatgacaaaacct
cttccgataaaaacatttaaactattaacaaacaaatggattcattag

DBGET integrated database retrieval system