KEGG   Saccharomyces cerevisiae (budding yeast): YDR224C
Entry
YDR224C           CDS       T00005                                 

Gene name
HTB1, SPT12
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR224C (HTB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDR224C (HTB1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    YDR224C (HTB1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YDR224C (HTB1)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-W YscO-like
Other DBs
NCBI-GeneID: 851810
NCBI-ProteinID: NP_010510
SGD: S000002632
UniProt: P02293
Structure
PDB: 

Position
IV:complement(914317..914712)
AA seq 131 aa
MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA
NT seq 396 nt   +upstreamnt  +downstreamnt
atgtctgctaaagccgaaaagaaaccagcctccaaagccccagctgaaaagaaaccagcc
gctaaaaagacttccacttccactgatggtaagaagagaagcaaggctagaaaggaaaca
tactcttcttacatttacaaagttttgaagcaaactcaccctgacactggtatttcccaa
aagtccatgtctatcttgaactctttcgttaacgatatctttgaaagaatcgctactgaa
gcttctaaattggctgcgtataacaagaagtctactatctctgctagagaaattcaaacc
gctgttagattgatcttaccaggtgaattggctaagcatgctgtctctgaaggtactaga
gctgttaccaagtactcttcctctactcaagcataa

DBGET integrated database retrieval system