KEGG   Saccharomyces cerevisiae (budding yeast): YDR262WHelp
Entry
YDR262W           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fasciclin DUF3132
Motif
Other DBs
NCBI-GeneID: 851855
NCBI-ProteinID: NP_010548
SGD: S000002670
UniProt: Q12331
Position
IV:993134..993952
Genome map
AA seq 272 aa AA seqDB search
MIFNLPVSVLLYFSLIWAMEPSFVRGKNVVNLITFKDSNGKLHKRLAPEEIPPRLHNSQV
NSYPLGYKGMRDFSRPAVNLDDILGTQQRKQQEFLAELSPLSLESKLSLVNEVQIFASYV
RNDVETYNKVSDPNEDLIIIAPTNRAVSQLTLKPWQFPNNIDKLESDGATEKELDTAIQE
NISKFVRSHIVVYNDDKNSYKKVSPGCTLLQSIDFTESKKSDSETGGDILLKKEGEVYYV
ASSRDEKFHAVESIENGSNGVILMVDFTLVGP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatattcaatctacctgttagtgtgctgctttatttttctttgatatgggcaatggag
cctagtttcgtaagaggtaagaacgtcgtcaacttaattactttcaaagattcaaatggc
aagctgcacaagcggttagcaccagaggaaataccgccccggctacataattctcaagta
aattcttatccattaggatataagggaatgcgtgacttttcaagacccgcagtgaattta
gatgatattttagggacacagcaaagaaagcagcaagagtttttggctgaattgtctcct
ttatccttagaatcaaagttgtcattagtgaacgaggtccaaatatttgcaagctatgtg
cgaaatgatgttgaaacatataacaaagtaagtgaccccaacgaagatttgattattatt
gcaccaacgaacagggctgtctctcagcttactttaaaaccgtggcaatttccgaataat
attgataagcttgaaagtgatggtgccaccgagaaggaacttgatacggcaatacaagag
aatatctccaaatttgtgagatctcatattgtagtgtacaatgatgataaaaattcctac
aagaaggtgagtccaggatgtacgctcctgcagagtattgacttcacagaaagcaagaaa
agcgattcggaaactggtggtgatattttactcaaaaaagaaggagaagtatattatgta
gcttcctccagagacgagaaatttcatgccgtcgagagcattgaaaatggaagcaatggt
gttattttgatggttgatttcaccctggtgggtccttag

DBGET integrated database retrieval system