KEGG   Saccharomyces cerevisiae (budding yeast): YDR272WHelp
Entry
YDR272W           CDS       T00005                                 

Gene name
GLO2
Definition
(RefSeq) hydroxyacylglutathione hydrolase GLO2
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YDR272W (GLO2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     YDR272W (GLO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2 Gp-FAR-1 Lactamase_B_3
Motif
Other DBs
NCBI-GeneID: 851865
NCBI-ProteinID: NP_010558
SGD: S000002680
UniProt: Q05584
Position
IV:1009010..1009834
Genome map
AA seq 274 aa AA seqDB search
MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH
HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC
HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS
KTRVYPGHEYTSDNVKFVRKIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPFM
RLEDPKVQKAAGDTNNSWDRAQIMDKLRAMKNRM
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttaaatcgattaaaatgagatgggagtctggtggtgttaattactgctatcta
ttgtccgacagtaaaaataaaaaatcgtggctaatcgatccagcagagcctcctgaggtt
ctgccagagttgactgaggatgagaaaataagtgttgaagcaattgttaatacacatcac
cattatgaccatgcagatggtaacgctgatatcttgaagtatttaaaagagaaaaatcca
acttcaaaagttgaggttataggagggtcaaaggactgcccaaaggttacgataattccg
gagaatttgaaaaagttacacctaggtgacttagagattacttgtattaggacgccctgc
cataccagagactctatctgttattatgtgaaagatccaacaacagatgagcgctgcatt
tttactggcgatacactatttaccgctggttgcggtaggttttttgagggtacaggcgaa
gaaatggatatagctctgaacaattctatcttagaaactgtgggcaggcagaactggagt
aaaacgagggtttatccaggacacgaatacacaagtgataatgtaaagtttgttcgtaag
atttacccgcaagttggtgaaaataaagcattggatgagttagaacaattctgctccaag
catgaagtcacagcagggcggttcactttgaaagatgaggtagaatttaatccattcatg
agattagaagatccaaaggtccaaaaagctgccggagatacgaataattcatgggacaga
gctcaaattatggataaattgagagctatgaaaaaccgtatgtag

DBGET integrated database retrieval system