KEGG   Saccharomyces cerevisiae (budding yeast): YDR279WHelp
Entry
YDR279W           CDS       T00005                                 

Gene name
RNH202
Definition
(RefSeq) Rnh202p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_H2-Ydr279 Ydr279_N AAA_assoc_2
Motif
Other DBs
NCBI-GeneID: 851873
NCBI-ProteinID: NP_010565
SGD: S000002687
UniProt: Q05635
Position
IV:1019368..1020420
Genome map
AA seq 350 aa AA seqDB search
MTVSNIGGEERLIILPDDYETSKTINTFTLPPPSNITSKPRIELFENINGKLYEIRSFQF
GKGPSYSHEEDLANDKYHYTKENHPIKSTFIVNTSDPTDGYVFNSSKIHFCSLYDIAFSL
IGFYYRNSVSADEQDYSNSSDTGENQKSNSKTNEKFLTVRDYHDFLTDNHDKNWENISLS
RLKSGLAKVSETIEEAGDVYYKITSAMITQFLLGKVSKIVENFPPSIPTLKNAPTEIKQC
YKVVMATNLLVSLIPRAAYHNLLTFSPTMDSGCLNPDIKASFIELENYETTNELQNAERE
LLMKSAMNVGLNSNGRVSLPVKKVTKKIVQNKKPKVAIGKGAIDGFFKRK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtttccaacattgggggggaagaacgactaataattttaccagacgattatgaa
acttcgaaaactataaacacttttacactgccgccaccttccaatattacatccaaacct
cgtatcgagctcttcgaaaatattaatggaaaactttacgaaataagatcttttcaattc
ggcaaagggccctcgtattcacatgaggaagatttggcaaatgataaatatcactatact
aaggaaaatcacccgatcaaatcaactttcattgtaaatacgtctgatcccaccgatggt
tatgtttttaactcaagcaaaatacacttttgttctttatacgatattgcttttagtttg
attggattttactatagaaacagtgtttcagcagatgaacaagattactccaattcaagt
gatactggtgaaaaccaaaaaagcaacagcaaaaccaatgagaaatttcttacggtgcgt
gattaccatgatttcttaacggataaccatgacaagaattgggaaaacatttctttaagt
cgtctcaagagtggcttagcaaaagttagtgaaaccattgaggaagctggtgacgtctat
tacaagatcacatctgcaatgataacacaatttttgttaggcaaggtatcaaaaattgta
gaaaactttcctccaagtatccctacacttaaaaatgccccaacggaaataaaacagtgc
tacaaggtagttatggctacaaatcttttagtttccctgattccaagggcggcctaccat
aatttacttaccttttcacctacaatggatagtggttgcctaaatccggatataaaagct
agcttcatagaactcgaaaactacgagactacgaacgaattacagaatgctgaaagagaa
ttactgatgaaaagtgccatgaatgtaggcctaaattcgaatggcagggtttcattgcca
gtgaaaaaagttaccaaaaaaatagttcaaaataaaaaaccaaaagtagccataggaaaa
ggggccattgatggattttttaaacgtaagtag

DBGET integrated database retrieval system