KEGG   Saccharomyces cerevisiae (budding yeast): YDR280WHelp
Entry
YDR280W           CDS       T00005                                 

Gene name
RRP45
Definition
(RefSeq) exosome non-catalytic core subunit RRP45
  KO
K03678  exosome complex component RRP45
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Module
sce_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YDR280W (RRP45)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDR280W (RRP45)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     YDR280W (RRP45)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C
Motif
Other DBs
NCBI-GeneID: 851874
NCBI-ProteinID: NP_010566
SGD: S000002688
UniProt: Q05636
Structure
PDB: 

Position
IV:1020747..1021664
Genome map
AA seq 305 aa AA seqDB search
MAKDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMGNTKVHCRI
SCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDV
EGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITVHGEQIIVHPVN
EREPVPLGILHIPICVTFSFFNPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLN
KNREVVQVSKAGGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSE
NAREI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagacattgagatatccgcatccgagtcaaaatttatcttagaagcactgaga
cagaattataggttggacggccgctcctttgatcaatttcgtgacgtggaaataacgttt
ggtaaagaatttggtgatgttagcgtaaaaatgggcaacaccaaagttcactgcaggatt
agttgtcaaatagcacaaccatacgaagacaggccatttgaaggattatttgtaatatct
acagaaatatctcctatggctggttctcaatttgaaaatggaaatatcacgggggaagat
gaagttttatgttcaagaataattgaaaaatctgttaggcggtcgggcgcattggacgtg
gaaggactatgtatcgttgctggcagtaaatgctgggctgtgagagctgatgtacatttc
ctggattgtgatggtggatttattgacgcttcgtgtattgccgtcatggcaggattgatg
cattttaagaaaccagatataactgtccatggcgagcagatcattgttcatcctgttaat
gaaagagagccagttccactaggtatactgcatattccaatatgtgtaactttttctttc
ttcaatcctcaagacaccgaggaaaacataaaaggtgagactaactcagaaatttccatc
attgatgcaacattgaaagaggaactactgcgagatggtgtattgacggttacgctaaac
aaaaaccgtgaagtggtacaagtttccaaagcgggtggtttaccaatggatgcgttgacg
ctaatgaaatgttgtcacgaggcttacagcattattgagaaaataactgatcaaatactg
cagcttttaaaggaggattcagaaaagagaaacaagtatgcagccatgcttacatctgaa
aatgcccgcgagatctaa

DBGET integrated database retrieval system