KEGG   Saccharomyces cerevisiae (budding yeast): YDR288W
Entry
YDR288W           CDS       T00005                                 

Gene name
NSE3
Definition
(RefSeq) Smc5-Smc6 complex subunit NSE3
  KO
K22823  non-structural maintenance of chromosomes element 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR288W (NSE3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     YDR288W (NSE3)
SSDB
Motif
Pfam: MAGE
Other DBs
NCBI-GeneID: 851882
NCBI-ProteinID: NP_010574
SGD: S000002696
UniProt: Q05541
Position
IV:1037195..1038106
AA seq 303 aa
MSSIDNDSDVDLTEDLAVAKIVKENPVARKMVRYILSRGESQNSIITRNKLQSVIHEAAR
EENIAKPSFSKMFMDINAILYNVYGFELQGLPSKNNMNAGGNGSNSNTNKSMPEPLGHRA
QKFILLNNVPHSKNFDDFKILQSAHTYEELIVTGEYIGDDIASGTSNTLESKLSTDRDLV
YKGVLSVILCIVFFSKNNILHQELIKFLETFGIPSDGSKIAILNITIEDLIKSLEKREYI
VRLEEKSDTDGEVISYRIGRRTQAELGLESLEKLVQEIMGLEKEQTKSLHDDIIKSIGDS
YSI
NT seq 912 nt   +upstreamnt  +downstreamnt
atgagttctatagataatgacagcgatgtggatttaacagaagatttagccgtggccaag
atcgttaaagagaatcctgtagctagaaaaatggttaggtatattttatcgagaggagaa
tctcaaaattcgatcataacaagaaacaagttacaatctgttatacatgaagctgctcgc
gaggaaaacatagcaaaaccgtcttttagtaaaatgtttatggacataaatgctatactg
tataacgtatatgggtttgaattacaaggattgccgtcaaaaaataatatgaacgctggc
ggtaatggaagcaatagcaatacaaataaatcaatgcctgagccactgggacatagagcc
cagaaatttatcttgctaaacaatgtcccgcactcaaaaaattttgacgatttcaagatt
ttacaaagcgctcacacttatgaagagctaatagttaccggagagtatattggtgacgat
atagcttcaggaacttccaataccttagaaagcaagttgagtacagatcgagatcttgtt
tacaagggtgttttgagcgtcattttatgcattgttttcttctctaagaataacatatta
catcaggaattgatcaaatttctagagacatttggcattccaagcgatggttcaaagatt
gctatactgaacattactattgaagatttgataaaaagtttagaaaagcgcgaatatata
gtcagattggaggagaaatccgataccgacggggaagtgatatcatacaggataggtaga
agaactcaggctgagcttggactagagtctcttgaaaaattggtgcaagaaatcatgggc
cttgaaaaggagcagactaaaagtttgcacgatgatataataaaaagcattggcgattca
tattctatatag

DBGET integrated database retrieval system