KEGG   Saccharomyces cerevisiae (budding yeast): YDR292CHelp
Entry
YDR292C           CDS       T00005                                 

Gene name
SRP101
Definition
(RefSeq) Signal recognition particle receptor subunit alpha
  KO
K13431  signal recognition particle receptor subunit alpha
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03060  Protein export
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    YDR292C (SRP101)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sce02044]
    YDR292C (SRP101)
Secretion system [BR:sce02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   YDR292C (SRP101)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRX SRP54 SRP-alpha_N SRP54_N AAA_31 MeaB ArsA_ATPase CbiA cobW Enterotoxin_a Fer4_NifH AAA_30 AAA_22
Motif
Other DBs
NCBI-GeneID: 851886
NCBI-ProteinID: NP_010578
SGD: S000002700
UniProt: P32916
Structure
PDB: 

Position
IV:complement(1043146..1045011)
Genome map
AA seq 621 aa AA seqDB search
MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVANANTDGFDFNL
LTINSEHKNSPSFNALFYLNKQPELYFVVTFAEQTLELNQETQQTLALVLKLWNSLHLSE
SILKNRQGQNEKNKHNYVDILQGIEDDLKKFEQYFRIKYEESIKQDHINPDNFTKNGSVP
QSHNKNTKKKLRDTKGKKQSTGNVGSGRKWGRDGGMLDEMNHEDAAKLDFSSSNSHNSSQ
VALDSTINKDSFGDRTEGGDFLIKEIDDLLSSHKDEITSGNEAKNSGYVSTAFGFLQKHV
LGNKTINESDLKSVLEKLTQQLITKNVAPEAADYLTQQVSHDLVGSKTANWTSVENTARE
SLTKALTQILTPGVSVDLLREIQSKRSKKDEEGKCDPYVFSIVGVNGVGKSTNLSKLAFW
LLQNNFKVLIVACDTFRSGAVEQLRVHVENLAQLMDDSHVRGSKNKRGKTGNDYVELFEA
GYGGSDLVTKIAKQAIKYSRDQNFDIVLMDTAGRRHNDPTLMSPLKSFADQAKPDKIIMV
GEALVGTDSVQQAKNFNDAFGKGRNLDFFIISKCDTVGEMLGTMVNMVYATGIPILFVGV
GQTYTDLRTLSVKWAVNTLMS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaccaattagcagtctttacccctcaaggtcaagtactttaccaatataactgt
ttaggaaaaaagttttctgaaatacaaattaacagctttatatcccagctgattacttcc
ccagtaactagaaaagaaagtgttgcaaacgcaaatacagacggatttgatttcaatctt
ttaacaatcaacagcgaacacaaaaattctccttcatttaatgcactattttatttgaat
aagcaaccagaattgtatttcgtagtgacttttgccgagcagactttagagcttaatcaa
gaaactcaacaaacacttgcactggtgttaaaactctggaactcattgcatttaagtgaa
tccattctaaaaaatcgtcagggccaaaacgaaaagaacaagcataactacgtcgatatt
cttcagggaattgaagacgacctgaagaaatttgagcaatattttaggataaaatatgaa
gagtcaataaaacaagaccatatcaatccagataattttaccaaaaatggatcagtaccc
caatcgcataataaaaataccaagaaaaaattgagggatacaaaaggtaagaagcaatct
acaggaaatgttggtagtgggagaaagtggggccgtgatggtggcatgcttgatgaaatg
aatcatgaagatgcagccaaattagatttctcatcatccaacagccacaatagtagccaa
gtagctctagactccactattaataaagattcttttggggatagaacagaaggaggcgat
ttcttaatcaaagaaattgatgatcttttgtcttctcataaagacgagataactagtggg
aacgaagctaaaaattctggatacgtcagtacagcttttggattccttcaaaaacacgtt
ctaggtaacaaaacgatcaatgaaagtgatttgaaatctgtattagagaagttaacacaa
caattgataaccaaaaatgtagcaccagaggcagcagactatttaacacagcaagtctca
catgatcttgtaggctcaaaaactgcaaattggaccagtgttgagaatactgctcgtgaa
tctttaacaaaagcattaactcaaatattaacgcctggtgtatccgttgatctcctccgt
gaaattcagagcaaaagaagcaaaaaggatgaagaaggtaaatgtgatccctatgtgttc
tctatagttggtgttaatggtgttggtaagtcaacaaatctttcaaagctagcgttttgg
ttactgcaaaataatttcaaggtcttaattgttgcttgtgatacgtttaggtctggtgca
gttgagcaactaagggtccatgttgaaaatttggcacagctaatggatgattcacacgtt
cgtggctccaagaacaaaaggggtaaaactggtaatgactacgttgaactatttgaagct
ggttatggtggatctgacttggtaaccaaaattgcaaagcaagccatcaaatattctcgt
gatcaaaacttcgatatagtgttaatggatactgccgggagaaggcataatgatcctact
ttaatgtcgccattgaagtctttcgctgaccaagccaagccagataaaatcattatggtt
ggagaggctttagtaggtactgattctgtccagcaagccaaaaattttaatgatgccttc
ggaaagggaagaaatcttgacttctttattatctccaagtgtgacacagttggtgaaatg
ctgggtactatggtaaatatggtttatgctacggggattcctatcttattcgttggcgtg
ggacaaacctataccgatttgaggacattaagcgtaaaatgggctgttaatacattaatg
tcttaa

DBGET integrated database retrieval system