KEGG   Saccharomyces cerevisiae (budding yeast): YDR293CHelp
Entry
YDR293C           CDS       T00005                                 

Gene name
SSD1, CLA1, MCS1, RLT1, SRK1
Definition
(RefSeq) mRNA-binding translational repressor SSD1
  KO
K18748  protein SSD1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDR293C (SSD1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Other mRNA localization factors
     YDR293C (SSD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_Dis3 Dis3l2_C_term CSD2 OB_RNB Rrp44_CSD1 Rrp44_S1
Motif
Other DBs
NCBI-GeneID: 851887
NCBI-ProteinID: NP_010579
SGD: S000002701
UniProt: P24276
Position
IV:complement(1045640..1049392)
Genome map
AA seq 1250 aa AA seqDB search
MSKNSNVNNNRSQEPNNMFVQTTGGGKNAPKQIHVAHRRSQSELTNLMIEQFTLQKQLEQ
VQAQQQQLMAQQQQLAQQTGQYLSGNSGSNNHFTPQPPHPHYNSNGNSPGMSAGGSRSRT
HSRNNSGYYHNSYDNNNNSNNPGSNSHRKTSSQSSIYGHSRRHSLGLNEAKKAAAEEQAK
RISGGEAGVTVKIDSVQADSGSNSTTEQSDFKFPPPPNAHQGHRRATSNLSPPSFKFPPN
SHGDNDDEFIATSSTHRRSKTRNNEYSPGINSNWRNQSQQPQQQLSPFRHRGSNSRDYNS
FNTLEPPAIFQQGHKHRASNSSVHSFSSQGNNNGGGRKSLFAPYLPQANIPELIQEGRLV
AGILRVNKKNRSDAWVSTDGALDADIYICGSKDRNRALEGDLVAVELLVVDDVWESKKEK
EEKKRRKDASMQHDLIPLNSSDDYHNDASVTAATSNNFLSSPSSSDSLSKDDLSVRRKRS
STINNDSDSLSSPTKSGVRRRSSLKQRPTQKKNDDVEVEGQSLLLVEEEEINDKYKPLYA
GHVVAVLDRIPGQLFSGTLGLLRPSQQANSDNNKPPQSPKIAWFKPTDKKVPLIAIPTEL
APKDFVENADKYSEKLFVASIKRWPITSLHPFGILVSELGDIHDPDTEIDSILRDNNFLS
NEYLDQKNPQKEKPSFQPLPLTAESLEYRRNFTDTNEYNIFAISELGWVSEFALHVRNNG
NGTLELGCHVVDVTSHIEEGSSVDRRARKRSSAVFMPQKLVNLLPQSFNDELSLAPGKES
ATLSVVYTLDSSTLRIKSTWVGESTISPSNILSLEQLDEKLSTGSPTSYLSTVQEIARSF
YARRINDPEATLLPTLSLLESLDDEKVKVDLNILDRTLGFVVINEIKRKVNSTVAEKIYT
KLGDLALLRRQMQPIATKMASFRKKIQNFGYNFDTNTADELIKGVLKIKDDDVRVGIEIL
LFKTMPRARYFIAGKVDPDQYGHYALNLPIYTHFTAPMRRYADHVVHRQLKAVIHDTPYT
EDMEALKITSEYCNFKKDCAYQAQEQAIHLLLCKTINDMGNTTGQLLTMATVLQVYESSF
DVFIPEFGIEKRVHGDQLPLIKAEFDGTNRVLELHWQPGVDSATFIPADEKNPKSYRNSI
KNKFRSTAAEIANIELDKEAESEPLISDPLSKELSDLHLTVPNLRLPSASDNKQNALEKF
ISTTETRIENDNYIQEIHELQKIPILLRAEVGMALPCLTVRALNPFMKRV
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaatagcaacgttaacaacaatagatcccaagagccaaataacatgtttgtg
caaaccacaggaggtggtaaaaacgccccaaagcagattcatgttgcacacagacgttcc
caaagtgagttgacaaatttgatgattgaacaattcactttgcagaagcagttggagcaa
gttcaagcacagcagcaacagttgatggctcagcaacagcaattggcacaacagacagga
caatacctgtcaggaaattctggctctaacaatcatttcacgcctcaaccgcctcaccct
cattacaactcaaacggtaattcacctggtatgagtgcaggtggcagcagaagtagaact
cactccaggaacaactccggatattatcataattcatatgataacaataacaatagcaat
aatcctgggtctaactcacacagaaagacgagttcacaatccagcatatatggccattcc
agaagacattctttaggtctaaatgaagcgaaaaaggctgctgcggaagaacaagctaaa
agaatatctgggggtgaagcaggcgtaactgtgaagatagattctgttcaagctgatagt
ggctcaaattctactacagaacaatctgattttaaatttccaccaccaccaaatgctcat
cagggccatcgtcgcgcaacttcaaacctatcacctccctctttcaaatttcctccaaac
tctcacggggataatgacgatgaattcatagcaacctcttcaacgcaccgccgttcaaag
acaagaaacaatgaatattctccaggcattaattccaactggagaaaccaatcacagcaa
cctcaacagcagctttctccattccgccacagaggatctaattcaagggattacaattcc
ttcaataccttagaacctcctgcgatatttcagcagggacacaaacatcgtgcctctaat
tcatcagttcatagtttcagttcacaaggtaataataacggaggtggacgtaagtcccta
tttgcaccctaccttccccaagccaacattccagagctaatccaagaagggagactagta
gctggtatattaagagttaataaaaagaatagatcggatgcctgggtctctacagatggc
gctcttgatgcggatatttacatttgcggctccaaagatcgtaatagagcacttgaaggt
gatttagtcgcggtagaactattagttgtggacgatgtttgggagtccaagaaagaaaag
gaagaaaagaagaggagaaaggatgcctctatgcaacacgatctaattcctttgaacagt
agtgacgattaccacaacgatgcatctgttactgctgcaacaagcaacaattttctatct
tctccctcctcgtctgattcgctaagcaaggatgatttatccgtcagaagaaagaggtca
tctactatcaataatgatagtgattccttatcatctcctaccaaatcaggagtaaggaga
agaagttcattgaaacaacgtccaactcaaaagaaaaatgacgatgttgaagttgaaggt
cagtcattgttattagttgaagaagaagaaatcaacgataaatataagccactttacgca
ggccatgtcgttgctgttttggaccgtatccctggtcagttatttagcggtacattaggt
ttgttgagaccatcccaacaagctaatagcgacaataacaaaccaccacaaagcccaaaa
attgcttggttcaagcctactgataagaaggtgccattaattgcaattcctacagaatta
gctccaaaggactttgttgaaaacgctgataaatactccgaaaagttattcgttgcctct
attaaacgttggccaatcacatctttgcatccatttggtattttagtttccgaacttgga
gatattcacgatcctgatactgaaattgattccattttaagggataacaattttctttcg
aatgaatatttggatcaaaaaaatccgcaaaaagaaaaaccaagttttcagccgctacca
ttaacggctgaaagtctagaatataggaggaattttacggacactaatgagtacaatatc
tttgcaatttccgagcttggatgggtgtctgaatttgccttacatgtcaggaataacgga
aatggtaccctagagctgggttgtcatgttgttgatgtgaccagccatattgaagaaggc
tcctctgttgataggcgtgcgagaaagaggtcctctgcggtgttcatgccacaaaaactt
gtcaatttattaccacaatcgttcaacgacgaactgtcgttggcccctggcaaggaatca
gccacgctgtcggttgtttacactctagactcatctactttaaggattaaatctacttgg
gtaggcgaatctacaatttccccctcaaacatcttgtctttagaacaattagacgaaaaa
ttatctactggaagtcccactagctacctctctactgtacaggaaattgctagatcattt
tatgctagaagaataaatgatccagaagctacattacttcccaccctgtccttattggaa
agcttggatgacgaaaaagttaaggttgacttgaacatcctggatagaactttaggcttt
gttgtaattaatgagattaaaagaaaggtcaactccactgttgcagagaaaatttacacc
aaacttggtgatctagctcttttgagaaggcagatgcaacccattgcaaccaagatggcg
tcatttagaaagaaaattcaaaattttggttacaattttgataccaatacggcggatgaa
ttaatcaaaggggtgctaaaaattaaagatgacgatgttagagtcggaattgaaatttta
ctgtttaaaaccatgccaagagctagatactttattgctggcaaagtagacccggaccaa
tatgggcattatgccttgaacctacctatctacacacatttcacagcgccaatgagaaga
tacgctgatcatgtcgttcataggcaattaaaggccgttatccacgatactccatacacc
gaagatatggaagctttgaagattacctccgaatattgtaattttaaaaaggactgtgct
tatcaagcacaggaacaagcaattcatctattgttgtgtaaaacaatcaacgacatggga
aatactacaggacaattattaacaatggctactgtcttacaagtttacgagtcctccttt
gatgtatttattccagaatttggtattgaaaagagagttcatggagatcaactacctttg
atcaaagctgagtttgatggtaccaatcgtgtcttggaattgcattggcagcccggcgta
gatagtgcaacttttataccagcagatgaaaaaaatccaaaatcctatagaaattccatt
aagaacaaattcagatccacagccgctgagattgcgaatattgaactagataaagaagcg
gaatctgaaccattgatcagcgatccattgagtaaggaactcagcgatttgcatctaaca
gtaccaaatttaaggctaccatctgcaagcgacaacaagcaaaatgctttagaaaaattc
atttctactactgaaaccagaattgaaaatgataactatatacaagaaatacatgaattg
caaaagattcctattctattgagagctgaggtggggatggctttgccatgtttaaccgtc
cgtgcattaaatccattcatgaagagggtataa

DBGET integrated database retrieval system