KEGG   Saccharomyces cerevisiae (budding yeast): YDR294CHelp
Entry
YDR294C           CDS       T00005                                 

Gene name
DPL1, BST1
Definition
(RefSeq) sphinganine-1-phosphate aldolase DPL1
  KO
K01634  sphinganine-1-phosphate aldolase [EC:4.1.2.27]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00600  Sphingolipid metabolism
sce01100  Metabolic pathways
Module
sce_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    YDR294C (DPL1)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.27  sphinganine-1-phosphate aldolase
     YDR294C (DPL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DegT_DnrJ_EryC1 SepSecS DUF436
Motif
Other DBs
NCBI-GeneID: 851888
NCBI-ProteinID: NP_010580
SGD: S000002702
UniProt: Q05567
Structure
PDB: 

Position
IV:complement(1050459..1052228)
Genome map
AA seq 589 aa AA seqDB search
MSGVSNKTVSINGWYGMPIHLLREEGDFAQFMILTINELKIAIHGYLRNTPWYNMLKDYL
FVIFCYKLISNFFYLLKVYGPVRLAVRTYEHSSRRLFRWLLDSPFLRGTVEKEVTKVKQS
IEDELIRSDSQLMNFPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDL
IHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSGGTESLL
LACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVK
KFINKNTILLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKN
LPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLA
GSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLNIMGNPRYSVIS
FSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQELKSE
SNSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLGPGEDTATK
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagtatcaaataaaacagtatcaattaatggttggtatggcatgccaattcat
ttactaagggaagaaggcgactttgcccagtttatgattctaaccatcaacgaattaaaa
atagccatacatggttacctcagaaataccccatggtacaacatgttgaaggattatttg
tttgtgatcttttgttacaagctaataagtaattttttttatctgttgaaagtttatggg
ccggtgaggttagcagtgagaacatacgagcatagttccagaagattgtttcgttggtta
ttggactcaccatttttgaggggtaccgtagaaaaggaagtcacaaaggtcaaacaatcg
atcgaagacgaactaattagatcggactctcagttaatgaatttcccacagttgccatcc
aatgggatacctcaggatgatgttattgaagagctaaataaattgaacgacttgatacca
catacccaatggaaggaaggaaaggtctctggtgccgtttaccacggtggtgatgatttg
atccacttacaaacaatcgcatacgaaaaatattgcgttgccaatcaattacatcccgat
gtctttcctgccgtacgtaaaatggaatccgaagtggtttctatggttttaagaatgttt
aatgccccttctgatacaggttgtggtaccacaacttcaggtggtacagaatccttgctt
ttagcatgtctgagcgctaaaatgtatgcccttcatcatcgtggaatcaccgaaccagaa
ataattgctcccgtaactgcacatgctgggtttgacaaagctgcttattactttggcatg
aagctacgccacgtggagctagatccaacgacatatcaagtggacctgggaaaagtgaaa
aaattcatcaataagaacacaattttactggtcggttccgctccaaactttcctcatggt
attgccgatgatattgaaggattgggtaaaatagcacaaaaatataaacttcctttacac
gtcgacagttgtctaggttcctttattgtttcatttatggaaaaggctggttacaaaaat
ctgccattacttgactttagagtcccgggagtcacctcaatatcatgtgacactcataaa
tatggatttgcaccaaaaggctcgtcagttataatgtatagaaacagcgacttacgaatg
catcagtattacgtaaatcctgcttggactggcgggttatatggctctcctacattagca
gggtccaggcctggtgctattgtcgtaggttgttgggccactatggtcaacatgggtgaa
aatgggtacattgagtcgtgccaagaaatagtcggtgcagcaatgaagtttaaaaaatac
atccaggaaaacattccagacctgaatataatgggcaaccctagatattcagtcatttca
ttttcttcaaagaccttgaacatacacgaactatctgacaggttgtccaagaaaggctgg
catttcaatgccctacaaaagccggttgcactacacatggccttcacgagattgagcgct
catgttgtggatgagatctgcgacattttacgtactaccgtgcaagagttgaagagcgaa
tcaaattctaaaccatccccagacggaactagcgctctatatggtgtcgccgggagcgtt
aaaactgctggcgttgcagacaaattgattgtgggattcctagacgcattatacaagttg
ggtccaggagaggataccgccaccaagtag

DBGET integrated database retrieval system