KEGG   Saccharomyces cerevisiae (budding yeast): YDR320CHelp
Entry
YDR320C           CDS       T00005                                 

Gene name
SWA2, AUX1, BUD24
Definition
(RefSeq) Swa2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ubiq-assoc TPR_2 TPR_12 Endonuc_BglI
Motif
Other DBs
NCBI-GeneID: 851918
NCBI-ProteinID: NP_010606
SGD: S000002728
UniProt: Q06677
Structure
PDB: 

Position
IV:complement(1106095..1108101)
Genome map
AA seq 668 aa AA seqDB search
MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP
LIPSPKVDFSAPPLVPTNSTTKSNTANNTPPSALANTDDDFNQLFGMGTVTTTDTIQKPD
EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK
QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN
DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT
KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT
DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA
SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL
ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKSMPVKKKTTTTSPATKKQN
LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL
TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK
FKLQNDIN
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatccatttgcacatttactgacttctttgaagaataaggactctgcatctgca
tccaaggaaacaactcctcagagcagcaattcgccttccattactggttccgctgttgca
gatgttgcaaggacggataaaagccccaatgatagtctgcattcaatttcagctcctccg
ctgataccgtcaccgaaggtagatttttctgcacctcctttggtcccaactaatagcacc
actaaatctaatactgccaacaacacacctccctcggctcttgccaataccgatgacgac
ttcaatcaactatttggtatgggcacagtaactacaacggatacgatccaaaaaccggat
gaggattactatggaagcaaggaagaccacctttacaatggtgatgacgccttagttgat
gaagttaaggatatggaaatagcaagattgatgtctctaggtttatcaattgaagaagcc
actgagttttacgaaaatgacgtaacttatgaaagatatttggagattttaaagtcaaag
caaaaggagcgcaacgatctagctataagaaagaaagaaagtggtataaaaatggaaaag
tcaggattatccaacattgttggtacagatagcaataatttattcagcatggccactgat
tttttcaataagggtaagaaactggtagaccaatggacctccttcccacctgaggcaaat
gatagactgaataattactcaaaaactcatgataaggttgaggattatgatttgcctcaa
gtaaacgactcacccaatagaattttgtttgaagataatgaagtcgtagagaacttacca
cctgccgataatccggatcaagatcttttaactgatttcgaaacaaagattgatataaca
aagaggacagcgcctgatgtctcccactcctcctcaccgacttctggtatactaattgaa
gaaaattcgcgaagaaatgagcccctgatagaggatagtcttctcgacttttcagaagga
aatctcaccaatagtaaaagcaatgaagatagcaccctcttcaatgaaaacagcaacact
gactctacaatacccatctcagatattgaattatcggggtataacgaatttaaggcgaaa
ggtactagtttgttcaagaacggggattatattaactcattacaagaatatgaaaagtct
ttaaatacattgcctttaaatcatccattgaggatcattgcattatcaaacattattgcc
tcgcaactgaaaatcggtgagtactctaagtccatagaaaactccagcatggctttggaa
ttattcccatcaagcaaagctaagtggaagaataaaatctcaaatagtgaccctgaaaga
tcatttaacgacatctggccaaagattatgattaggcgtgctgagtcttttgaacattta
gaaagtttcaaaaaagcactagaaacataccaagagctgattaagaagaatttttttgat
gataaaatcatgcagggaaaaagaagatgccaagactttattaatcctccccctgttaaa
aaatccatgcccgttaagaagaagacaacgacaacctcgcctgcaacaaaaaaacagaac
ttaaccgcttcttcttcaaattctccaatttctgttgatagcacttcagaaataaaaaaa
cgggagctagaaaacgctaaactggcgctatatgataaagtatttgagaaaattagctcc
tggaaggatggcaaagacgatgacattcgtcatctgttagcaaatttatccagcttacta
acatggtgcaattggaaggatgtctctatgcaagatttggttatgcctaagagggtcaaa
attacatacatgaaagctgtagccaagacacatcctgataagataccagagtccttgtcc
ctggaaaataagatgattgcagagaatattttcagtactttaagtattgcttgggataag
ttcaaactgcagaatgacattaactga

DBGET integrated database retrieval system