KEGG   Saccharomyces cerevisiae (budding yeast): YDR324CHelp
Entry
YDR324C           CDS       T00005                                 

Gene name
UTP4
Definition
(RefSeq) Utp4p
  KO
K14548  U3 small nucleolar RNA-associated protein 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YDR324C (UTP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YDR324C (UTP4)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    YDR324C (UTP4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 851924
NCBI-ProteinID: NP_010611
SGD: S000002732
UniProt: Q06679
Position
IV:complement(1114433..1116763)
Genome map
AA seq 776 aa AA seqDB search
MSSSLLSVLKEKSRSLKIRNKPVKMTSQERMIVHRCRFVDFTPATITSLAFSHKSNINKL
TPSDLRLAIGRSNGNIEIWNPRNNWFQEMVIEGGKDRSIEGLCWSNVNGESLRLFSIGGS
TVVTEWDLATGLPLRNYDCNSGVIWSISINDSQDKLSVGCDNGTVVLIDISGGPGVLEHD
TILMRQEARVLTLAWKKDDFVIGGCSDGRIRIWSAQKNDENMGRLLHTMKVDKAKKESTL
VWSVIYLPRTDQIASGDSTGSIKFWDFQFATLNQSFKAHDADVLCLTTDTDNNYVFSAGV
DRKIFQFSQNTNKSQKNNRWVNSSNRLLHGNDIRAICAYQSKGADFLVSGGVEKTLVINS
LTSFSNGNYRKMPTVEPYSKNVLVNKEQRLVVSWSESTVKIWTMGTDSSTEQNYKLVCKL
TLKDDQNISTCSLSPDGQVLVVGRPSTTKVFHLQPVGNKLKVTKLDNDLLLRTSTKLVKF
IDNSKIVICSCEDDVFIVDLESEEDEKPQEVELLEVTSTKSSIKVPYINRINHLEVDQNI
AVISRGCGVVDILDLKARISKPLARLNNFITAVHINTSRKSVVVITADNKIYEFNMNLNS
EAENEDSESVLTQWSKNNTDNLPKEWKTLKENCVGIFSDIENSSRLWFWGATWISRIDFD
VDFPINKRRKQKKRTHEGLTITDESNFMNDEEDDEDDDIDMEISENLNVLLNQGNKIKST
DVQRNEESSGHFFFTDKYKPLLFVDLISSNELAIIERNPLTFHSKQKAFIQPKLVF
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgagctcatcgctactttcagttttaaaagaaaagtcaagaagcctgaaaatacgaaac
aaaccggtgaagatgaccagtcaggaaaggatgatagtgcatagatgcagatttgtggat
ttcactcctgccacaatcacatctctagcattttcacataaatcaaatataaataagtta
actccgtccgatttgagattagctattggtagatctaatggtaacatagaaatctggaat
cctagaaacaattggtttcaggaaatggttatcgaaggtggcaaagacagatcaattgaa
ggcctttgctggagcaacgttaacggcgagtctctaaggctattttctattggcggctcg
actgtggtaacagaatgggatttagcaacaggtttaccattaagaaactatgattgcaat
tcaggtgtgatatggtctatttccatcaacgattcacaagacaagctgtctgtgggttgc
gataatgggacggtggtcctcatagatatctctggcgggcctggtgtcttggaacacgat
actattttgatgagacaagaagccagagtattgactttggcttggaaaaaggatgacttc
gtgattggtggttgttctgatggtagaataaggatttggtctgcacaaaaaaatgacgaa
aacatgggtcgtctattacacactatgaaggtcgacaaggccaaaaaagaatcaactcta
gtttggtcagttatatatttaccaagaactgatcagattgcctctggtgattctacaggc
tccattaaattctgggatttccagtttgccacgctaaaccagtcatttaaggcgcacgat
gcagacgtactgtgtctaactaccgatactgataataattatgtttttagtgctggtgtg
gacagaaaaatctttcaattttctcaaaacactaacaaatctcaaaagaacaacagatgg
gtaaattcttctaataggttgcttcatggaaacgacattagagcaatatgtgcataccaa
tctaaaggtgcagattttctagtttcaggaggtgttgaaaaaacactagtcatcaactca
cttacttctttttctaatggaaactacaggaagatgccaactgtcgaaccttattcaaag
aatgttttagttaacaaagagcaacgccttgttgtttcatggagcgaatctactgttaag
atatggacaatgggaaccgattctagtacagaacagaattataagctagtttgcaagtta
actttaaaagatgaccagaatatctcaacttgttctttatcacctgatggacaagtttta
gtcgtagggaggccctctaccactaaagtttttcatttacagcccgtaggtaataaattg
aaagtgactaaactagataatgacctattattgagaacttccacaaaattagtcaagttc
atcgataattccaaaattgtcatatgctcttgcgaagatgatgtatttattgtggatcta
gaatctgaagaagatgaaaaaccgcaagaagttgaacttttggaggttacttcaactaag
agcagtatcaaagttccctatattaacaggatcaaccatttggaagtagaccagaacatt
gcagtaatttctcgtggctgtggagtcgtagacatattagacttaaaagcaaggatttct
aaaccacttgctcgtttgaataatttcatcaccgctgttcatatcaatacttctagaaaa
tctgtagtagtaattactgcagacaataagatttatgaattcaatatgaatttgaattcg
gaagccgagaatgaagatagcgaaagcgtattaactcaatggtcaaaaaacaatacggat
aacttaccaaaagaatggaagacattaaaagagaactgtgtagggatattttcagacata
gaaaatagtagcagattatggttttggggggctacttggatatcaagaatagactttgat
gttgacttccctataaataagagaagaaaacagaaaaaacgtacacacgaagggctaact
atcacagatgaaagtaatttcatgaacgacgaggaagatgacgaagatgacgatattgat
atggaaatcagcgaaaacttgaatgtattattaaaccaaggaaacaaaataaagtccaca
gatgtacaaagaaacgaagaaagctccggtcacttcttctttactgataaatataaacct
ttactgtttgttgacttaatttctagtaatgaattggcaataattgaaagaaatccatta
acttttcactccaaacaaaaggcgtttattcaaccaaagttagtgttttga

DBGET integrated database retrieval system