KEGG   Saccharomyces cerevisiae (budding yeast): YDR326CHelp
Entry
YDR326C           CDS       T00005                                 

Gene name
YSP2, LAM2, LTC4
Definition
(RefSeq) Ysp2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VASt GRAM
Motif
Other DBs
NCBI-GeneID: 851926
NCBI-ProteinID: NP_010613
SGD: S000002734
UniProt: Q06681
Structure
PDB: 

Position
IV:complement(1120609..1124925)
Genome map
AA seq 1438 aa AA seqDB search
MRDEATRKKRSFSDGHFFKKLKLMSRKKQPVMERSKTTRTRKESTNSAAKSSLSLRRANN
GRKTIAKRRVLTDIGSTNEGVAGNSGSNSPAQYSHTPHFSDSIPPLPLELPDIVSIRSSR
SHISNKSNKNKHGIDLTFIPRRSLQNSKAGLKKPNTSPQGYFNIPVTIDRASEKVKHTDT
KNTFNSSSSENERPVLSILQKDDSQSSSHPAIDSMSAPNNINNNNDIENSSNSLFDTILS
IAHSAISHVPKISALNTEIQREFSHSGESHTGSTRHPYFHIHHAQQQHPLSQQQGPLPVS
ENANQNPNDTVLIHSPSANTAHRSSSFLRHLDYLLSPTSGPASDKHTQVEEGDDEEELSP
LSKAFLSPSTQLVPTNTSTTPLSGSLTPNNRNVNANSNSETENDNDRDDRSNVGKVKFQP
LKVHEPAISTFGKGNLTLEAVAGSSDIDNTTIDLDENNTNNNPNASSTNLSHISKSNVNN
NLGPKELNTSYRNSTYIDMARFENSQSNLSSHRARSKTLPANKALENAVGDEGNSKRNSR
YSSYSNDMAFDDADERKFRSMSKKFLNRRSFSPSNLGNKVIPGINLRNSFNKNRNSSSDF
FSTNQGQQMPRTSTAGSGNIHAIMGLDSGNDDFKLEGIEYASEKKNSEFHTLFKDCDINP
NEKLIVDHSCALSRDILLQGRMYISDAHIGFFSNILGWVSTVFIPFKEIVQIEKKTTAGI
FPNGIVIDTLHTKYIFASFMSRDATFDLITDVWNQIILGKKYRNGFGNNDDGTISDSSSA
FFDDSDDNDDDGDLDDDDPDINSTDMTSSDDIDADVFNESNDLGKNQKSTNYLLGPNKHS
PTTADFKPSNNDHLVIEANINAPLGKVVNLLYGEDVSYYERILKAQKNFEISPIPNNFLT
KKIRDYAYTKPLSGSIGPSKTKCLITDTLEHYDLEDYVKVLSITKNPDVPSGNIFSVKTV
FLFSWDKNNSTKLTVYNSVDWTGKSWIKSMIEKGTFDGVADTTKIMISEIKKILSDEDSN
INSKHQASNNESEEEIINLPTIGPPVHDPTEPDFQKGKDDTVIDEKINIPVPLGTVFSLL
YGDDTSYIKKIIENQNNFNVCDIPKFVNNAREITYTKKLNNSFGPKQTKCIVTETIEHMD
LNSFFMVKQIVRSPDVPYGSSFSVHTRFFYSWGDHNTTNMKVVTNVVWTGKSMLKGTIEK
GSIDGQRSSTKQLVDDLKKIISNASSTKKKSRRRGKTVNKRKSSPSTIKNEKNEENFEDT
STKNSFFSAFSMLQQVNITSVQGIMTIISFFICLIFFFRLLFHSKNTSNIQIITPGTILI
NGNEYNYVPNFKTLYHVYEDNIIKDARRKDSNKNNIVTDTEGLIWDWLIDRGNGTVQNSV
LSNHIKESNNKKVKLVNGVSDHKIQQLVESIKITELQLQEMKELLAQTDNTSATNQLL
NT seq 4317 nt NT seq  +upstreamnt  +downstreamnt
atgagggatgaagctactcgcaaaaaaaggtcatttagtgatggtcattttttcaagaaa
ctgaaattgatgtcaaggaaaaagcaacctgttatggaaagaagtaagaccactcgtaca
aggaaggaatctaccaattccgcagcaaaatcatccctatcattaagaagggccaacaat
ggcagaaagaccatcgctaagagaagagtactgaccgacataggctctactaatgaaggt
gttgccggtaactctggttcaaactctcctgctcaatattctcatactcctcattttagt
gattctatcccaccactgcctttagagctaccagatatcgtctcaataaggagtagtaga
agtcatattagtaataagagtaataagaacaaacatggtatagacttgactttcatacct
cgaagatcgctacaaaattctaaggctggcttgaagaaaccgaatacttctccacaaggt
tattttaatattccagtgactatagatagagcaagtgagaaagtcaaacatactgatact
aaaaatacattcaattcttcgtcttctgagaatgaacgaccagttttgagcatcttacag
aaggatgactctcaaagttcttcgcacccagctatcgattcaatgtcagcacccaataat
attaacaacaataacgacattgagaattcttcaaacagtctatttgatactattctatca
attgctcatagtgccatatctcatgtccctaaaatttcagccttaaatactgagatacaa
cgtgaattttcgcattcaggtgaaagtcatacaggttcaactcgccatccttatttccat
atccaccacgcgcagcagcaacatcccttgtcacagcaacaagggcccttacctgtttcc
gaaaatgctaaccaaaatcccaatgacacagtgctcattcattccccctccgctaacaca
gcccaccgcagttcatcatttttgcgtcatttagattatttactatcccccacttctggt
ccagcctctgataaacatactcaagtagaggaaggggatgacgaggaagagttatcgcct
ctttccaaagcatttctttcaccatcaactcaactggtacctacaaatacatcgactacg
cccctttcaggttctttgacacctaacaatagaaacgtaaatgcaaactctaactctgaa
accgagaacgacaatgatagggatgatagatcaaatgttggcaaagtgaaatttcagccc
ttgaaagtacacgagcctgcaatctcaacctttggtaaaggcaacttaactttagaggca
gtggcaggatcctctgatattgataatacaactattgatctggacgagaataataccaat
aataatccaaatgcaagttcaacaaacttgagtcatattagcaaaagtaacgtaaacaat
aatctcggtccaaaagaattaaacacaagttatcgtaatagtacctatatcgacatggca
aggtttgaaaattcacaatcgaacctttctagccatagggcaagaagtaagacactgccc
gcgaacaaagcattagagaatgccgttggtgatgaaggtaatagtaaaagaaattcaaga
tattcttcttattcaaacgatatggcctttgatgatgccgacgaaagaaaattcagaagt
atgtccaaaaaattcttaaacaggagatctttttcaccttcgaacttaggcaataaagtg
atccctggaattaatttaagaaattcattcaacaaaaataggaatagtagttctgatttc
tttagtacaaatcagggacagcaaatgccaagaacaagtactgcgggctcaggtaatatc
catgcaataatgggtttggattctggcaatgatgatttcaagttagaaggtattgaatat
gcttcagaaaagaaaaacagcgaatttcatacccttttcaaggactgcgatattaatcct
aacgaaaagttaattgtcgatcatagttgtgcactatctcgtgatattcttttacaagga
aggatgtatatatctgatgcacacattggatttttctcaaacattttgggatgggtcagt
acagttttcattccgtttaaggaaatcgttcagattgagaaaaagactaccgccggaatt
ttccccaatggtattgtaattgatacgttgcatacaaagtacatcttcgcctcttttatg
tcaagggatgctacctttgatttaattacagatgtatggaatcagatcatcttaggtaaa
aaatataggaatggcttcggtaataatgacgacggtacgataagcgattcgagcagtgca
ttttttgatgattccgatgacaatgacgacgatggagacctggatgacgatgaccctgat
attaatagcacagatatgacatctagtgacgatattgatgctgatgttttcaatgaatca
aatgatcttggtaaaaaccaaaaatctacgaactacttattgggtcccaataaacactct
ccaaccactgctgatttcaaaccttccaataatgatcatttggttattgaagcaaatatt
aatgcaccattaggaaaagtagtaaatcttttatacggtgaagacgtctcttactatgaa
aggatccttaaagctcagaaaaattttgaaatatcgccaatccctaacaatttcctcaca
aagaaaattcgtgactatgcatatacgaaaccgttatcaggcagcattggtccaagtaaa
acaaaatgtttgatcacagatactttagagcattatgatttggaagactatgttaaagtg
ctcagtattaccaagaacccggatgttccttcagggaatatcttttcagtgaaaactgtt
ttccttttctcttgggataaaaacaactccaccaaattaacagtttacaattctgttgat
tggactggtaaaagttggatcaaaagtatgattgaaaagggaacatttgatggtgttgcg
gacaccacaaagataatgatatctgaaattaagaaaatcttaagtgatgaagactcaaac
ataaactcaaagcatcaagccagcaataatgaatcagaagaagaaattattaatctgcca
actattggacctccagttcatgatccgacggaacctgattttcaaaaaggaaaagacgat
acagttatcgatgaaaaaattaatataccagttcctttaggaacagtgttttcactattg
tatggtgatgacacatcatatattaagaaaatcatcgaaaaccagaataactttaatgtt
tgtgatattccaaagtttgtgaataacgcaagagagatcacctataccaaaaaattgaac
aattcattcggtccgaagcaaactaaatgtatagtcacagagaccatcgagcatatggat
ttgaacagtttttttatggtaaaacaaatagtcagatctccggatgttccttacggtagt
tcattttcagtacatacgagatttttctattcctggggtgatcacaacacaacgaacatg
aaagttgtcaccaatgttgtctggacaggtaaatcaatgctgaaaggaaccattgagaaa
ggttcaattgatggacaaagaagttcaacaaagcaactcgtagatgatctcaaaaaaata
atttctaatgctagttcaacgaagaaaaaatcgaggagaagaggaaagacggtaaataaa
aggaaatcatcaccatccactatcaagaatgagaagaatgaagaaaacttcgaagataca
agtaccaaaaattcatttttttccgctttctcaatgttacaacaagtaaacataacatcc
gttcaaggaattatgacaattatctctttttttatttgcttgattttcttctttagatta
ttattccattctaagaatacttcgaacatccagattattactccaggaacaatcttaatt
aatggaaatgaatataattacgttcctaattttaaaacactctatcatgtttacgaagat
aatattataaaagatgcccgccgtaaagactcgaataaaaataacatagtcaccgatacg
gagggtctcatatgggactggttgatagatcgtggaaatggaaccgttcaaaatagtgtc
ttgtccaatcatattaaggagagtaataacaagaaggttaagctcgtaaatggagttagt
gatcataaaatacagcagctagttgaatctataaaaatcaccgaattgcagctgcaagaa
atgaaagaattattggcccaaacggataacacgtcggctactaaccaattactttga

DBGET integrated database retrieval system