KEGG   Saccharomyces cerevisiae (budding yeast): YDR330WHelp
Entry
YDR330W           CDS       T00005                                 

Gene name
UBX5
Definition
(RefSeq) Ubx5p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_7 UBX UBA_4 C2-set
Motif
Other DBs
NCBI-GeneID: 851930
NCBI-ProteinID: NP_010617
SGD: S000002738
UniProt: Q06682
Position
IV:1127872..1129374
Genome map
AA seq 500 aa AA seqDB search
MSEGKVDEFMAITGADDAAIATQFIEMADGNLNTAISLFFENGGAALLSSNNTPTPSNST
PMAPTSVDSDADAQLAERLQREAYQQQQPDQDYVRPPDEARHEVLTETSGFPISYGGIGG
RFEPLHRVNDMFDEGRPESIFNQRLDDTNTNTYINDNSSDSLDSEEENDDDEYEYVEEPV
IELDEDGNIKEYTKLVRKPKTISKEQKLALLFRPPFSIMSKLDLDAAKQKARAKQKWIMI
NIQDSGIFQCQALNRDLWSSRPVKTIIKENFVFLQYQYESRNAQPYLQFYHLNNKDDLPH
IAILDPITGERVKQWNRVVPIPEQFISEINEFLASFSLDPKVPNPTVNEPLPKVDPTTLT
EEQQMELAIKESLNNNSSKSNQEEVPSTGEEQKRVQEPDPFSTIEARVHPEPPNKPGITT
RIQIRTGDGSRLVRRFNALEDTVRTIYEVIKTEMDGFADSRFTLNDHQREDLIDKLNMTI
ADAGLKNSSLLLEKLDPEIE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagggaaaagtagacgaatttatggccatcactggcgctgatgacgctgctatt
gccactcaattcatcgaaatggcagacgggaacttgaacacagccatatcattgtttttc
gaaaatggtggggctgctttactgagcagtaacaacacacctactccgtctaattcgact
cctatggcgcccacctctgtagattcagatgccgatgcacaattagcggagaggttgcaa
agggaagcttaccaacaacaacagcctgaccaagattatgtcaggccacctgatgaggca
agacatgaagtacttactgaaacttcaggattcccaatttcttacggcggcattggcgga
agatttgaaccattgcatagggtgaacgacatgtttgacgaaggaagacctgaaagcatt
tttaatcaacgattggatgacacaaatactaatacatacatcaatgacaactcttcagat
tccttggactccgaggaagaaaatgacgacgacgaatatgagtatgtggaagagccggtc
atcgaacttgatgaagacggcaatatcaaggagtacaccaaattagtgagaaagcctaaa
accatttccaaggagcagaaattagctttgttatttaggcctccattttcaatcatgtcc
aaactcgacttagacgctgcaaagcaaaaggcaagggcaaagcaaaaatggataatgatt
aacattcaggattcaggaatcttccaatgccaagccctcaacagggatttgtggtcgtcc
agaccggtaaaaactataatcaaagagaacttcgttttcctacagtatcaatatgaatca
cgtaatgcccaaccctatcttcagttctatcacttgaataataaggatgatttgccccat
atcgcgatactggatccaattaccggtgaacgtgtcaagcaatggaatagggttgttccc
attccagagcaattcatctcagaaatcaacgagtttttggcctcattttcgctagatcca
aaggtccctaatcccacggttaatgaacctcttcctaaagtggatccaacaactttgacc
gaagagcaacaaatggaattagccattaaagagtcattaaataataactcgagcaaatca
aaccaagaagaagtgccgagtactggcgaagaacagaaacgagtacaagaaccggatcca
ttcagtaccattgaagccagggtgcatccagaaccgccaaataaaccagggatcactaca
agaattcaaattcgtaccggtgatggctccagactagttcgtagattcaatgctctggaa
gacactgtgcgtactatttacgaggttatcaagacagaaatggatggttttgccgattca
agattcacactaaatgatcaccaaagagaggacttgattgataaattaaacatgaccata
gcggacgccggcttaaaaaatagttctttactacttgagaagcttgaccctgaaatagaa
taa

DBGET integrated database retrieval system