KEGG   Saccharomyces cerevisiae (budding yeast): YDR331WHelp
Entry
YDR331W           CDS       T00005                                 

Gene name
GPI8
Definition
(RefSeq) GPI-anchor transamidase
  KO
K05290  phosphatidylinositol glycan, class K [EC:2.6.-.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    YDR331W (GPI8)
Enzymes [BR:sce01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.-  Transferring nitrogenous groups
    2.6.-.-  
     YDR331W (GPI8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C13 Peptidase_C14 Internalin_N
Motif
Other DBs
NCBI-GeneID: 851931
NCBI-ProteinID: NP_010618
SGD: S000002739
UniProt: P49018
Position
IV:1129588..1130823
Genome map
AA seq 411 aa AA seqDB search
MRIAMHLPLLLLYIFLLPLSGANNTDAAHEVIATNTNNWAVLVSTSRFWFNYRHMANVLS
MYRTVKRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNKDHAIDLYGDSVEVDYRGYEVT
VENFIRLLTDRWTEDHPKSKRLLTDENSNIFIYMTGHGGDDFLKFQDAEEIASEDIADAF
QQMYEKKRYNEIFFMIDTCQANTMYSKFYSPNILAVGSSEMDESSYSHHSDVEIGVAVID
RFTYYCLDFLEQIDKNSTLTLQDLFDSFTFEKIHSHVGVRTDLFDRNPSEVLITDFFANV
QNVIPDDSKPLSVSHYHHYKDHIDTAQYELNNNVLDLALETYRKNNQSSKIEKKIKDIKS
TSVLDVDIDSNECFFTSFKQSATIILALIVTILWFMLRGNTAKATYDLYTN
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatagcgatgcatctgccgctgttgcttttatacatattcttactacccctttca
ggtgcaaataacacagatgctgcacacgaagttatagcaacgaacacaaataattgggcc
gtattagtatccacgtcgcggttctggttcaattacaggcacatggctaatgtccttagt
atgtataggactgtaaagaggttaggtataccggattcacaaataatattgatgctgagt
gatgatgtggcctgcaattcaaggaatctatttcctggaagtgtttttaacaataaggat
cacgctattgacctttacggagactctgtagaggttgactacagaggttacgaagttacc
gtggaaaactttataaggctgttaacggatagatggacagaagaccatcctaaatctaaa
cggttgttgacggatgaaaattcaaatatattcatctatatgacaggacatggtggcgat
gattttttaaagttccaagatgctgaagagattgcttctgaagatattgcagatgcattc
cagcaaatgtacgaaaagaaaagatacaatgaaatcttctttatgatagatacatgtcag
gcaaacacaatgtattccaagttttattctccaaatattctggctgtaggctctagtgaa
atggatgaaagctcgtactcgcatcactcggacgtagaaataggggttgctgttattgat
agattcacctattactgtttggatttcctagaacaaatcgataaaaattccacgttaact
ttgcaggacctcttcgattcattcaccttcgaaaagattcactctcatgtgggtgtcagg
actgatctgtttgataggaatccgtcagaagtattgattactgatttttttgcgaatgtg
caaaacgtaattcctgatgattcaaaacctctttccgtaagtcattatcatcattacaaa
gatcatatcgatactgctcagtatgagcttaacaataatgtgctggatttggccttggag
acttaccgcaaaaacaatcaatcctccaagattgaaaaaaaaatcaaagacatcaagtct
actagtgtattggatgttgatatagattccaacgaatgtttcttcacctccttcaaacaa
tcagctaccataatactggcgcttatagtaactattctgtggttcatgctgagaggaaac
actgctaaagcaacctatgacctgtacactaattaa

DBGET integrated database retrieval system