KEGG   Saccharomyces cerevisiae (budding yeast): YDR334WHelp
Entry
YDR334W           CDS       T00005                                 

Gene name
SWR1
Definition
(RefSeq) chromatin-remodeling protein SWR1
  KO
K11681  helicase SWR1 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR334W (SWR1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YDR334W (SWR1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromatin remodeling factors
   SWR1 complex
    YDR334W (SWR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII HSA DEAD
Motif
Other DBs
NCBI-GeneID: 851934
NCBI-ProteinID: NP_010621
SGD: S000002742
UniProt: Q05471
Structure
PDB: 

Position
IV:1135932..1140476
Genome map
AA seq 1514 aa AA seqDB search
MTTSRKSHAKDKKAGGEQDLADLKFRYDLLTNELFHLREFVSLVDYDPTHFNDSESFQKF
LRETHLSLEERGEKFTDDVAKKGTNGDLTRRRRNLRTSTVVSSETTNEKKGDIELKLESI
APLVRNKCEELKYKLSDHSNRKSIVPQKRPIQHLKKREAAKSLKFKSERKENPLPLHEHI
AEERYDHIAKVEEPSEAFTIKCPSDDSSFENTSEHYSDNFYFTTSSEEEDIKKKRGRKKK
KPRIKLVVHPPKQTITNPLHVVKPGYESLHEYIASFKSLEDDLTLEEYNKYIDEQRRLLS
RLKKGIENGALKYDKETDSLQPITSKEIKTIITYKPDPISYFYKQQDLQIHTDHLINQGI
HMSKLFRSSTKARIARAKKVSQMIEQHFKHVAGAEERKAKEEERHKKSLARFAVQAVKKR
WNMAEKAYRILRKDEEEQLKRIEGKQHLSKMLEKSTQLLEAQLNQVNDDGRSSTPSSDSN
DVLSESDDDMDDELSTSSDEDEEVDADVGLENSPASTEATPTDESLNLIQLKEKYGHFNG
SSTVYDSRNKDEKFPTLDKHESSSSESSVMTGEESSIYSSSENESQNENDRESDDKTPSV
GLSALFGKGEESDGDLDLDDSEDFTVNSSSVEGEELEKDQVDNSAATFERAGDFVHTQNE
NRDDIKDVEEDAETKVQEEQLSVVDVPVPSLLRGNLRTYQKQGLNWLASLYNNHTNGILA
DEMGLGKTIQTISLLAYLACEKENWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSP
QQRKEKRKGWNKPDAFHVCIVSYQLVVQDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQAL
LNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGRPVDK
IIETGQNFGQDKETKKTVAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFL
YDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPNLFEVRPILTSFVLEHCVASDYKD
VERTLLKLFKKNNQVNRVDLDFLNLVFTLNDKDLTSYHAEEISKLTCVKNFVEEVNKLRE
TNKQLQEEFGEASFLNFQDANQYFKYSNKQKLEGTVDMLNFLKMVNKLRCDRRPIFGKNL
IDLLTKDRRVKYDKSSIIDNELIKPLQTRVLDNRKIIDTFAVLTPSAVSLDMRKLALGLN
DDSSVGENTRLKVMQNCFEVSNPLHQLQTKLTIAFPDKSLLQYDCGKLQKLAILLQQLKD
NGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDSRITVFILS
SRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNIL
KKANQKRQLDNVVIQEGDFTTDYFSKLSVRDLLGSELPENASGGDKPLIADADVAAKDPR
QLERLLAQAEDEDDVKAANLAMREVEIDNDDFDESTEKKAANEEEENHAELDEYEGTAHV
DEYMIRFIANGYYY
NT seq 4545 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatctcgtaaatcgcatgcgaaagacaaaaaggctggtggtgaacaggatctg
gcggatttgaagtttaggtatgatcttctgacgaatgaactgttccatttaagagagttt
gtttcattggtagattatgatccaacccattttaatgattctgaaagttttcagaagttt
ctcagggaaacacacttgtcgttagaggagagaggagaaaaattcactgatgacgtagcc
aagaaaggcacgaatggtgatcttactcgcagaaggcgaaacctcaggacatcgacagtt
gttagttcagaaacgactaatgagaaaaagggtgatatagaactgaagttagaaagcata
gcaccattagtacgaaataaatgtgaggagctaaaatacaaactaagtgatcattcaaat
aggaaatctatagtaccgcaaaaaagaccaatacaacatttgaagaagagagaagcagcg
aagtccttgaagttcaaaagtgaaagaaaggaaaatccactgccattgcatgaacatata
gctgaagagagatatgatcacatcgcaaaagttgaagaaccctctgaagccttcactata
aagtgtccttctgatgatagctcctttgaaaatactagtgaacattatagtgataatttt
tatttcaccacatcatccgaagaggaagatataaagaaaaaaagaggtagaaagaaaaag
aagcctagaataaaactggtagtccatcctccaaagcaaaccataacgaacccgttgcat
gtagtcaagccgggatacgaaagcttgcacgaatacatcgcttcctttaagtcattagaa
gacgatttaacgctggaagaatataataaatacatcgacgaacaaagacggcttttatcg
agactcaaaaaaggtattgaaaatggcgcattgaagtatgacaaagaaacggactcacta
caacctataacatccaaggaaatcaagactatcataacatataaaccagacccgatttca
tatttctataaacaacaagatctgcaaatccataccgatcacttaattaaccaaggtatt
catatgagtaagctgtttagaagttcaacaaaggcaagaatagcaagagccaaaaaggtt
tctcaaatgatagaacaacattttaaacacgtagccggagcagaagaaagaaaggcaaag
gaggaggagaggcacaaaaagtcgctagccaggttcgcagttcaagctgttaaaaaaaga
tggaatatggctgagaaggcttataggattttgagaaaagatgaagaagaacagttaaaa
aggattgaaggtaagcaacacctttctaaaatgttggagaaaagtacacaattgttggaa
gctcagctaaaccaagtaaatgacgatgggagaagcagtaccccgtcttctgactcaaac
gatgtattgagtgaaagtgacgatgatatggatgacgaattatcaacatcttccgatgaa
gacgaagaggtcgatgctgatgtggggctagaaaatagtccagcatcgacggaagctact
ccaacagacgaatcattaaatctgatacaattgaaagaaaaatacgggcattttaatggt
tcatcgacagtatatgactcaagaaataaagatgagaagtttccgacattggataaacat
gaaagttcaagtagtgaaagttctgtaatgactggagaggagtcctccatatattcatcc
tctgaaaatgaaagtcaaaacgaaaatgatcgagaatcggacgacaagactccatctgtg
ggtttaagtgcattatttggtaaaggtgaggaatcggatggggatttagaccttgacgat
agtgaagattttacggttaatagctcatctgtagaaggtgaagaacttgaaaaagaccaa
gttgacaattcagctgctacatttgaaagagcaggtgattttgttcacactcaaaatgaa
aatagggacgatataaaagatgtcgaggaagatgctgaaacaaaagtacaagaagaacag
ttatcagtggtggatgtacctgtgccatctttattaagaggaaacttaagaacgtaccag
aaacaaggtttgaattggttagcctctctttataacaatcacacaaatggtatcctggca
gacgagatggggttaggtaaaactattcagacaatttctctgctagcatatttagcttgt
gaaaaggaaaactgggggccacatcttattgttgttcctacatcagttctgttgaactgg
gagatggaattcaaaaggttcgcgcctgggtttaaggttttaacatattatggttctccc
cagcaacgtaaagaaaaaaggaaaggttggaataagcctgatgctttccatgtttgtatt
gtttcttaccaacttgtagttcaagatcaacattcctttaagagaaagagatggcaatat
atggtgctggatgaagcacacaatatcaaaaacttcagatctacaagatggcaggctcta
ttgaatttcaacacacaaagaaggcttctgttgactggtacacctttacagaataacctt
gctgagctgtggtcattattatatttcttaatgccccagactgttattgacgggaaaaag
gtttctggatttgctgatcttgatgcatttcaacaatggtttggacgccctgtcgataaa
attattgaaacgggtcagaattttggacaggacaaggaaacgaagaagacagttgccaag
ttgcatcaagttttacgtccatacctcttaagaaggttaaaggccgatgttgagaaacaa
atgccagcgaagtatgagcatattgtttattgtaagctatctaaaagacaaaggttctta
tatgatgattttatgtctagagctcaaacgaaagcaacactagccagtggaaattttatg
tcaattgtcaactgtttgatgcaattgagaaaggtgtgtaaccatcccaatttatttgaa
gtgaggccaatattaacatcatttgtccttgaacattgtgtagcttccgactacaaggat
gtagaaaggactctgcttaaattgttcaaaaaaaacaatcaagttaaccgggttgacttg
gatttcttgaacttggtgtttacgcttaatgacaaagatttaacttcttatcatgccgag
gaaatctcaaaactgacgtgtgtaaaaaacttcgttgaagaagtcaataaattgagggaa
accaataaacagcttcaggaggagtttggagaggcgtcttttttaaattttcaagatgca
aatcaatatttcaagtattctaataagcagaaacttgaagggacagttgacatgctaaac
tttctaaagatggtaaataaacttagatgcgacagaagacccatattcggaaagaacctt
attgacctattaacgaaagatagaagggttaaatatgataaatcaagcattattgataat
gaactaataaaacccttgcaaaccagggtattggataatagaaagatcatagataccttt
gcagtgttaaccccaagtgccgtctcactagatatgagaaagttggcattgggattaaat
gatgacagttcggtaggcgaaaacacaaggctaaaggtaatgcagaactgttttgaagta
tccaacccattacaccaactgcaaaccaaattaacaatcgcattcccggacaaatcgctg
cttcaatacgattgtggtaaattgcagaagttagcaattttattacagcagctgaaggac
aatggacatagggcacttatcttcacacaaatgacaaaagttttggacgttctggaacag
tttttaaactatcatggttatttgtatatgagactagatggtgccacaaagatcgaagac
cgtcaaatcctaacagagagattcaacactgactcaagaataacggtatttatcctatca
agtagatcaggagggctaggtatcaatctgactggggcagatacagttattttttacgat
tcagattggaatccagccatggacaaacagtgtcaagatagatgtcacagaattggacag
actcgagatgtgcatatttacagatttgtcagcgaacataccatagaaagcaatatctta
aaaaaagccaaccaaaaaagacaattggataatgttgttattcaagagggtgacttcaca
acagattatttcagcaaactttcggtgagagatttattgggatccgaattgcccgaaaat
gcttcaggtggagataaaccactaatagcagatgcagatgtggcagccaaagatcccaga
caactggaaagacttcttgcgcaagcggaagatgaggatgatgttaaagctgcaaactta
gccatgagagaagtcgaaattgacaatgacgatttcgacgaaagcacagaaaaaaaagca
gctaatgaagaggaagaaaatcatgctgaacttgatgagtatgagggcactgcccatgtt
gacgagtacatgatcaggtttattgccaacggttattattattga

DBGET integrated database retrieval system