KEGG   Saccharomyces cerevisiae (budding yeast): YDR335WHelp
Entry
YDR335W           CDS       T00005                                 

Gene name
MSN5, KAP142, STE21
Definition
(RefSeq) karyopherin MSN5
  KO
K14289  exportin-5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YDR335W (MSN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YDR335W (MSN5)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR335W (MSN5)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    YDR335W (MSN5)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     YDR335W (MSN5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orbi_VP6
Motif
Other DBs
NCBI-GeneID: 851935
NCBI-ProteinID: NP_010622
SGD: S000002743
UniProt: P52918
Position
IV:1141168..1144842
Genome map
AA seq 1224 aa AA seqDB search
MDSTGASQIVSALDVIYSPKSNNSQRQEAQKFLDEVKLCSESPFWGYEIALQNPTNSILK
YFGLGLLDHAVKKNWNDYDEGKRVALRKWVMELNFGVQDYDTRYIKEKLATLWVEVAKRT
WGEALKQTNPTEEQLLTSWVDMDNNLFELWNINQSSRELALIIFRILFEDVFLLDDLIVL
KRMTVIQPLCVMIVCPIEVFAIKYKFSDKWTKFKANEEGWFSVWIPELNNALQQNNSEYI
IRLLETLKTCLNWPLTEVIVRNDVLSSLLTCLSSNIPRAQSMALDSIHILLTRPYSNESH
YQMTIDRVFDNMDLLDSVYESLLFDPTDDIDETKYPIIKKFVDMISCLYVCVPKIKETNG
QIQKYFKLVLKTTYNPSLIVSGLTLDLWCTCLRNDEYLPKLEKYVIPDLLQFAADALVYY
EQIDGHISKKFAEIDFQSKSEFQTFCSTYRKRIRDIIRLISCVELDLTYDWLNNRLNNYF
SSPFGQQVLSSTFLDHKLEPYLGALSQYMIVECFINGCIRWKIWYPTGDDYDEKLDSILQ
KLEILSNQLIALNLREPLLLKKQIQNFALFLTMLKDNVLFTLLEKIITSATMDYPEINLE
ERGAESDAVRDLRYACGIELNRMALLMPESLKKIYPDLESVIARIMPNLSYHEKISFKSF
LLIIVLKSSLDMKEERFAAIVDPELLAWSDKTTVVGLSDLHWFMERLGIVQIAEYFQRRD
IDENSDLLSIPIDDEGKELKSELTKRWQSLFPVRATRMFIHYSMQSIKTDEEFKMLQDLW
RPRIVPILPYITRLLYQLQSYHDPDNWKGLPTVVQSFVKYSTIERFWEAGASNKSKDEFI
DEHMKAMQTLRDFADSVGHIIRYTREYTLLVLSAISSLGSVFYLLDESPDLLLNSIAIFK
PGSNEISPGVSTHGWKHIMNIAIRPILKGCPKDCLGKFMPAFLPKLFEILDLLLCQKWSS
HMNDMDMNPVPTDDDQMTEEILEENLLRQLTTVVVRIVIDCVGQGNANPNSAKSRLNNHQ
MEMRKIIFNDLNTLAPFLKLLNHLISFKDTKCSFNSILVMKCCLTSVLNQNNTVDEYFTF
EVMKNLLLNVLCNSAFKDSFHEALYAFTVIFLTLCKEYPSARAFLFEISNGYNIDELYRN
LRSVDEYKTQRALMIDFIDWVKSTSGKEDGNVDHAGDERKRQEKREAILKKANERLIKKN
KENGDMLDDPNIEDGAVGNLFDDN
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atggattccacaggcgcttctcagattgttagcgcactagatgttatttactcccccaag
tctaacaattctcaacggcaagaagctcagaaatttttagatgaagtgaaattatgctca
gaatcgcccttttggggctacgaaattgcattgcaaaaccccactaattctatattgaaa
tactttggactaggattactagaccatgcagtgaagaaaaactggaatgattatgacgag
gggaaaagagtggccctgagaaaatgggtcatggaacttaattttggggtgcaagattat
gataccagatatattaaggaaaaattagccactttatgggtagaggtggcaaaaagaaca
tggggtgaggctcttaagcagacaaaccctacggaagaacagttactcacatcttgggtg
gacatggacaataaccttttcgaactttggaacataaatcaatcgtcaagagaactagca
ttaataattttcagaatcctttttgaagatgttttcttgttggacgacctaattgttttg
aaaaggatgacggttattcaacccttatgtgtaatgattgtttgccctattgaagttttc
gcaataaaatacaaattcagtgataaatggaccaaatttaaagctaatgaagagggctgg
ttttctgtttggattccagagttgaataatgcattacaacagaataattctgaatacatc
ataaggcttttagaaactctgaagacgtgtttaaactggccattaacagaggtcattgta
agaaatgacgtgttatcctccttattgacttgtttatccagcaatatcccaagggcgcag
tcaatggcattagactcgatacatattctgttgacccgtccctatagtaatgaaagccat
taccaaatgaccatagatcgagtttttgataatatggacttattagatagcgtttatgaa
agcttgttgtttgatcctacagatgatatagatgaaacgaaatatcctataattaaaaag
ttcgtggatatgatcagttgtctctatgtttgtgtcccaaagattaaggagacaaatggc
caaattcaaaaatattttaagcttgtattaaagacaacttataacccaagcttaatcgtt
agcggattaacattagacctatggtgtacctgtcttcgaaacgatgaatacttacccaag
ctggagaaatatgtcattcctgatctactacagtttgccgcggatgctttagtctattat
gaacagattgatggtcatatttccaaaaaatttgcggagattgattttcaatccaagtcc
gaatttcaaacattttgttccacttataggaaaagaataagagacatcattaggttgatt
tcttgcgtcgaattagaccttacttatgattggttgaacaacagattaaacaattatttc
agctctccatttggtcagcaggtcttaagttccacatttttggaccataaattagagcct
tatttaggtgccctctcccaatacatgattgttgaatgtttcatcaatggttgtataaga
tggaagatctggtatccaacaggagatgattatgacgaaaaactagattccatattacaa
aaactggaaattttgtcaaaccagttaattgcattaaatttaagagaaccattgttattg
aagaaacaaatccaaaattttgcactttttttgacaatgttaaaagataatgtgcttttc
acacttttagaaaaaatcataacaagcgccacgatggactatccagaaattaatttggaa
gagagaggcgctgaatcagacgcagttagagatttgagatatgcttgtggtatcgagttg
aataggatggctttattaatgcccgaatctctgaaaaaaatatacccagaccttgaaagt
gtcattgccagaatcatgcccaacttatcttaccatgaaaaaatttccttcaaatccttc
ttattgatcattgtattgaagtcttcattagatatgaaagaggaaagatttgcggctatt
gtggatccagaacttttagcctggtctgataaaacaacagttgttggtctttctgatttg
cattggtttatggaacgcttaggtattgttcagatcgcagaatatttccagaggcgtgat
atcgacgaaaatagtgaccttttatcaattccaattgatgatgagggtaaagagctgaag
tcggaattgaccaaacgttggcaaagcttgtttcctgttcgtgcaacaagaatgttcatt
cattattcaatgcaaagtataaagacagatgaagaattcaaaatgctacaagatctgtgg
agacctaggattgtcccaatattaccttacatcacgagactactgtaccaattgcaatcc
taccacgatccagataattggaaaggattacctacggttgtgcaatccttcgtcaagtat
tccactattgaaagattttgggaggccggagcttcaaataaatcaaaggatgagtttatt
gatgaacatatgaaagcgatgcaaaccttacgagacttcgccgactccgtaggacacatc
attaggtatacaagggaatacactctacttgttttaagtgccatatcatcacttggtagt
gttttttaccttttggacgaatcgcccgacctactactgaactctattgccatatttaag
ccaggtagcaatgagataagccctggagtttcaacacatggatggaaacacataatgaat
atagccattcgtcctatattaaaaggttgtccaaaagattgtctggggaaattcatgccc
gcatttttgcctaaattatttgaaatcctggacctgctgctatgtcagaaatggtcctcg
catatgaatgatatggacatgaacccagttccaactgacgatgatcaaatgactgaagaa
attttggaagagaatttgttgagacaactaaccacagttgttgttagaatagtaattgat
tgtgttggtcaaggcaatgccaatccaaacagtgctaaaagcaggctaaataaccatcaa
atggagatgagaaaaattatatttaatgatttaaacacccttgctccatttttgaaactt
ttgaaccatttaatttccttcaaggatacaaaatgttcatttaactccatcctagtaatg
aaatgctgcttaacctcagtccttaatcaaaacaacacggtggatgaatatttcacattt
gaagtgatgaaaaatctgttgctaaatgtgctgtgtaatagtgcgtttaaggattctttc
catgaggcactatatgctttcactgtgatttttttgactctgtgcaaagaatatccctct
gctagagcgttcctttttgagatatctaatggttataatattgatgagttatacagaaat
ttaaggagcgtggacgaatacaaaacacaaagggcactcatgattgattttatagattgg
gttaaatccaccagtgggaaagaagatggtaatgtggaccatgcaggcgatgagagaaaa
agacaagagaaaagggaagctatcctcaagaaggcaaatgagagattaattaagaagaat
aaagaaaacggagacatgctggatgatccgaacattgaagacggtgctgtgggtaatctc
tttgatgacaactga

DBGET integrated database retrieval system