KEGG   Saccharomyces cerevisiae (budding yeast): YDR378CHelp
Entry
YDR378C           CDS       T00005                                 

Gene name
LSM6
Definition
(RefSeq) U4/U6-U5 snRNP complex subunit LSM6
  KO
K12625  U6 snRNA-associated Sm-like protein LSm6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
sce03040  Spliceosome
Module
sce_M00396  Lsm 2-8 complex
sce_M00397  Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YDR378C (LSM6)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YDR378C (LSM6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:sce03019]
    YDR378C (LSM6)
   03041 Spliceosome [BR:sce03041]
    YDR378C (LSM6)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     YDR378C (LSM6)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     YDR378C (LSM6)
Spliceosome [BR:sce03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    YDR378C (LSM6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LSM SM-ATX LSM14
Motif
Other DBs
NCBI-GeneID: 851984
NCBI-ProteinID: NP_010666
SGD: S000002786
UniProt: Q06406
Structure
PDB: 

Position
IV:complement(1229349..1229609)
Genome map
AA seq 86 aa AA seqDB search
MSGKASTEGSVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNN
NKLLNKFNSDVFLRGTQVMYISEQKI
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaaagcttctacagagggtagcgttactacggagtttctctctgatatcatt
ggtaagacagtgaacgtcaaacttgcctcgggtttactctacagcggaagattggaatcc
attgatggttttatgaatgttgcactatcgagtgccactgaacactacgagagtaataac
aataagcttctaaataagttcaatagtgatgtctttttgaggggcacgcaggtcatgtat
atcagtgaacaaaaaatatag

DBGET integrated database retrieval system