KEGG   Saccharomyces cerevisiae (budding yeast): YDR385WHelp
Entry
YDR385W           CDS       T00005                                 

Gene name
EFT2
Definition
(RefSeq) elongation factor 2
  KO
K03234  elongation factor 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sce03012]
    YDR385W (EFT2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDR385W (EFT2)
Translation factors [BR:sce03012]
 Eukaryotic type
  Elongation factors
   YDR385W (EFT2)
Exosome [BR:sce04147]
 Exosomal proteins
  Proteins found in most exosomes
   YDR385W (EFT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU EFG_IV EFG_C EFG_II GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 851993
NCBI-ProteinID: NP_010673
SGD: S000002793
UniProt: P32324
Structure
PDB: 

Position
IV:1243230..1245758
Genome map
AA seq 842 aa AA seqDB search
MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAAKAGEARFTDTR
KDEQERGITIKSTAISLYSEMSDEDVKEIKQKTDGNSFLINLIDSPGHVDFSSEVTAALR
VTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVDRALLELQVSKEDLYQTFAR
TVESVNVIVSTYADEVLGDVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKM
MDRLWGDSFFNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFRLFTAIMNFKKDEIPVLL
EKLEIVLKGDEKDLEGKALLKVVMRKFLPAADALLEMIVLHLPSPVTAQAYRAEQLYEGP
ADDANCIAIKNCDPKADLMLYVSKMVPTSDKGRFYAFGRVFAGTVKSGQKVRIQGPNYVP
GKKDDLFIKAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLTTSETAHNMKV
MKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEI
CLQDLEHDHAGVPLKISPPVVAYRETVESESSQTALSKSPNKHNRIYLKAEPIDEEVSLA
IENGIINPRDDFKARARIMADDYGWDVTDARKIWCFGPDGNGPNLVIDQTKAVQYLHEIK
DSVVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLA
DPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGF
TGELRQATGGQAFPQMVFDHWSTLGSDPLDPTSKAGEIVLAARKRHGMKEEVPGWQEYYD
KL
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggttgctttcactgttgaccaaatgcgttctttaatggacaaagttaccaatgtgcgt
aacatgtccgttattgctcacgtcgatcatggtaagtccactttgaccgattccttggtc
caaagagccggtattatttccgctgctaaggctggtgaagctcgtttcaccgataccaga
aaggatgaacaagaaagaggtatcactatcaagtctaccgctatttctctatactctgaa
atgtctgacgaagatgtcaaggaaatcaagcaaaagaccgacggtaactccttcttgatc
aacttgatcgactctccaggtcacgttgacttctcctctgaagttactgccgctttacgt
gtcactgacggtgctttggttgtcgtcgacaccattgaaggtgtctgtgtccaaaccgaa
actgttttgagacaagctttgggtgagagaatcaagcctgttgttgttatcaacaaggtc
gacagagctttgttggaattgcaagtttctaaggaagatttataccaaacctttgccaga
actgttgaatccgttaacgtcatcgtttccacctacgccgatgaagttttgggtgatgtc
caagtttacccagccagaggtaccgttgccttcggttccggtttgcacggttgggctttc
actatccgtcaattcgccaccagatatgctaagaaattcggtgtcgacaaggccaagatg
atggacagattatggggtgactctttcttcaacccaaagaccaagaagtggaccaacaag
gacactgatgctgaaggtaagccattggaaagagctttcaacatgttcatcttggaccca
atcttcagattattcactgctatcatgaacttcaagaaagatgaaattccagttttgcta
gaaaagttggaaattgtcttgaagggtgacgaaaaggacttggaaggtaaggccttgttg
aaggttgttatgagaaagttcttgccagctgccgatgccttattggaaatgattgtcttg
cacttgccatctccagtcactgctcaagcctacagagctgaacaattatacgaaggtcca
gctgacgatgccaactgtattgctatcaagaactgtgatccaaaggctgatttgatgttg
tacgtctccaagatggtgccaacctctgataagggtagattctacgccttcggtagagtt
tttgccggtactgttaagtccggtcaaaaggtcagaatccaaggtccaaactacgttcca
ggtaagaaggacgatttgttcatcaaggccattcaaagagttgttttgatgatgggtaga
tttgtcgaaccaatcgatgactgtccagccggtaacattatcggtttagtcggtatcgat
caattcttgttgaagactggtactttgaccaccagtgaaactgctcacaacatgaaggtc
atgaaattctctgtctctccagttgtgcaagtcgctgtcgaagtcaagaacgctaacgac
ttaccaaaattggtcgaaggtttgaagagattgtccaagtctgatccatgtgtcttgacc
tatatgtctgaatccggtgaacatatcgttgctggtaccggtgaattgcatttggaaatt
tgtttgcaagatttggaacacgaccacgctggtgttccattgaagatctccccaccagtt
gtcgcttacagagaaactgttgaaagtgaatcttctcaaactgctttgtccaagtctcca
aacaagcataacagaatctacttgaaggctgaaccaattgacgaagaagtctctttggct
attgaaaacggtatcatcaacccaagagatgatttcaaggccagagctagaatcatggct
gacgactacggttgggatgtcaccgatgccagaaagatctggtgtttcggtccagacggt
aacggtccaaacttggttattgaccaaactaaggctgtccaatacttgcacgaaatcaag
gattccgttgttgctgctttccaatgggctaccaaggaaggtccaattttcggtgaagaa
atgagatctgtcagagttaacattttggatgttactttacatgccgatgctatccacaga
ggtggtggtcaaatcatcccaaccatgagaagagctacttacgctggtttcttgttggct
gatccaaagatccaagaaccagttttcttggtcgaaattcaatgtccagaacaagccgtc
ggtggtatctactccgtcttaaacaagaagagaggtcaagtcgtttctgaagaacaaaga
ccaggtactccattgtttaccgtcaaggcctacttgccagttaacgaatctttcggtttc
actggtgaattgagacaagctactggtggtcaagctttcccacaaatggttttcgaccat
tggtccactttaggttctgacccattggacccaacctctaaggctggtgaaattgttctt
gctgctcgtaagagacacggtatgaaggaagaagttccaggctggcaagaatattacgac
aaattgtaa

DBGET integrated database retrieval system