KEGG   Saccharomyces cerevisiae (budding yeast): YDR402C
Entry
YDR402C           CDS       T00005                                 

Gene name
DIT2, CYP56
Definition
(RefSeq) putative cytochrome P450
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 852011
NCBI-ProteinID: NP_010690
SGD: S000002810
UniProt: P21595
Position
IV:complement(1272234..1273703)
AA seq 489 aa
MELLKLLCLILFLTLSYVAFAIIVPPLNFPKNIPTIPFYVVFLPVIFPIDQTELYDLYIR
ESMEKYGAVKFFFGSRWNILVSRSEYLAQIFKDEDTFAKSGNQKKIPYSALAAYTGDNVI
SAYGAVWRNYRNAVTNGLQHFDDAPIFKNAKILCTLIKNRLLEGQTSIPMGPLSQRMALD
NISQVALGFDFGALTHEKNAFHEHLIRIKKQIFHPFFLTFPFLDVLPIPSRKKAFKDVVS
FRELLVKRVQDELVNNYKFEQTTFAASDLIRAHNNEIIDYKQLTDNIVIILVAGHENPQL
LFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLADLPLLNAFLFEVVRMYPPLSTIINRC
TTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERWGSDIETIRKNWRMAK
NRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFRWSLDPEWEEKLTPAGPLCPLNLK
LKFNENIME
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggagttgttaaagcttctgtgtttgattttatttcttactctttcctatgtcgccttt
gcaatcattgtcccacctctaaactttcccaaaaatatacccaccatcccattttatgta
gtatttttaccagtaatatttcccattgatcaaacggagctatacgatctttatattagg
gaatcaatggaaaaatacggtgctgtaaaatttttctttggttcacggtggaatattctc
gtttctcgttctgagtatctagcacaaatattcaaagatgaagatacttttgcgaagagc
ggtaatcaaaagaaaatcccatacagtgctcttgccgcttacacaggggacaatgtcatt
agcgcgtatggtgcagtttggagaaactacagaaatgctgtgacaaacgggctccaacat
tttgacgatgcacctatattcaaaaatgcaaaaattttatgcactttgataaaaaacaga
ctcctagaaggacaaacttcgatccctatgggacctttatcccagagaatggcattggat
aacatttcacaggttgcccttggatttgattttggtgctctaacacatgaaaaaaatgct
ttccacgagcatttgattcgtattaaaaagcaaatatttcatccattctttttaactttt
ccattccttgatgttcttcctattccttcaagaaaaaaagccttcaaggatgttgttagt
tttagagaacttctcgttaaaagagttcaagatgaattagtcaataattacaaatttgaa
caaactacttttgctgccagtgatctaattcgtgctcacaataacgaaataatcgactac
aaacagttgaccgataatatcgtcattatccttgtcgctggccatgaaaacccgcagttg
ctatttaatagttcactctaccttctagccaaatattcaaatgaatggcaagagaaactc
aggaaggaagtaaacggcatcactgatccaaaaggcttagcagatttacccttattaaat
gcttttctcttcgaagtagtaagaatgtatcctcctttgagcacaattattaatagatgt
actaccaaaacgtgcaagttgggggcggaaattgttatacccaagggcgtatatgtcggg
tacaacaactttggaacctcacacgatcccaaaacttggggcacaacagcagatgatttt
aaaccagaaagatggggttcagatatcgaaaccataaggaaaaactggagaatggcgaaa
aacagatgtgctgtgactgggttccatggaggccgaagagcatgcctaggggaaaaacta
gccctaacagaaatgagaatttctttggctgaaatgttgaaacagtttcgatggagtctt
gaccctgaatgggaagaaaaattaactcccgctgggcctctttgccctcttaatttaaag
ttaaaatttaacgagaatataatggaataa

DBGET integrated database retrieval system