KEGG   Saccharomyces cerevisiae (budding yeast): YDR410CHelp
Entry
YDR410C           CDS       T00005                                 

Gene name
STE14
Definition
(RefSeq) protein-S-isoprenylcysteine carboxyl O-methyltransferase
  KO
K00587  protein-S-isoprenylcysteine O-methyltransferase [EC:2.1.1.100]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00900  Terpenoid backbone biosynthesis
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YDR410C (STE14)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.100  protein-S-isoprenylcysteine O-methyltransferase
     YDR410C (STE14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICMT PEMT DUF1295 NnrU HRG
Motif
Other DBs
NCBI-GeneID: 852019
NCBI-ProteinID: NP_010698
SGD: S000002818
UniProt: P32584
Position
IV:complement(1292372..1293091)
Genome map
AA seq 239 aa AA seqDB search
MHQDFQEDEHEYPDIRRNPLHEVTMTSYILGILLGIFVGLFPQIRFKNFNLFIIALSLFH
FLEYYITAKYNPLKVHSESFLLNNGKSYMAAHSFAILECLVESFLFPDLKIFSYSLATKL
CTVLGCLLVILGQYTRTIAMHTAGHSFSHIVKTKKESDHVLVKTGVYSWSRHPSYLGFFW
WAIGTQLLLLNPLSLVIFIFVLWKFFSDRIRVEEKYLIEFFSAEYIEYKNKVGVGIPFI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaagattttcaagaagacgagcatgagtatccagacatcagacgcaatccgctg
catgaggtgaccatgacttcctacatactggggattcttttaggtatatttgttggtctt
tttccacaaattagattcaagaattttaacctctttattattgccctgtccttattccat
tttttggagtattatattacagctaaatacaatcctcttaaggtacattcagagtccttt
cttctgaacaacggcaaaagttacatggcggcacattcctttgctattctggaatgcctc
gtagaaagctttctttttcctgatctgaaaatttttagctactctctagctaccaagctt
tgtacagtacttggatgtcttctagttattctgggacaatataccagaactattgctatg
catactgcgggacattccttttctcatattgtgaagaccaagaaggagtccgatcatgtt
ttagtgaaaactggcgtttactcctggtcaagacatccaagttatcttgggttcttttgg
tgggcaattggcactcagctactgcttctaaatcccctatcattggttattttcattttt
gtactttggaaatttttcagtgatagaattcgtgtggaagaaaaatatttgatagagttc
tttagcgcggaatacatagaatacaagaataaggttggtgtcggaataccttttatataa

DBGET integrated database retrieval system